DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and AT4G29950

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_567836.2 Gene:AT4G29950 / 829118 AraportID:AT4G29950 Length:828 Species:Arabidopsis thaliana


Alignment Length:419 Identity:76/419 - (18%)
Similarity:139/419 - (33%) Gaps:150/419 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   395 IREKDIEYQFQRVRLFARLLQGYPHTAEQLQR--EAAVDVPPLLRGPIWAALLEVVPNGSYAKID 457
            :|:...|.:.:...|..|||.. ||.::.::.  :.::|.|           |...|:.::.:. 
plant    42 LRKATAESRRRYAALRRRLLID-PHLSKDVRNSPDLSIDNP-----------LSQNPDSTWGRF- 93

  Fly   458 KFTSTSTDRQIEVDIPRCH-QYDELLSSPDGHRKLRRLLKAWVTAHPQYVYWQGLDSLTAPFLY- 520
             |.:...::.::.|:.|.: ::.....:|.....|||:|..|...||:|.|.||:..|.||.|| 
plant    94 -FRNAELEKTLDQDLSRLYPEHWSYFQAPGCQGMLRRILLLWCLKHPEYGYRQGMHELLAPLLYV 157

  Fly   521 -------------------------LNFNNEELAFLSLFKFIPKYLQWFF------LKDNSAVIK 554
                                     |:|...::.:...||   |:|:.|.      ::.||..||
plant   158 LHVDVDRLSEVRKSYEDHFIDRFDGLSFEERDITYNFEFK---KFLEDFTDDEIGGIQGNSKKIK 219

  Fly   555 ----------------------------------------------------------------- 554
                                                                             
plant   220 SLDELDPEIQSIVRLSDAYGAEGELGIVLSEKFMEHDAYCMFDALMNGVHGCVAMAGFFAYSPAS 284

  Fly   555 ----------EYLSKFSQLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWDK 609
                      |..:.|..|.:|.:..|..||..:...|:.|.:.|...:|...|.|..:|.:||:
plant   285 GSHTGLPPVLEASTAFYHLLSFVDSSLHSHLVELGVEPQYFGLRWLRVLFGREFLLQDLLIVWDE 349

  Fly   610 LMLGDS------------SYPLF----------IGIAILRQLRSTLL-TSGFNECILLFSDLPDI 651
            :...|:            ||.:|          :.::::..|||:|| |.....|:....:.|:.
plant   350 IFSADNTTRTDADNNTNQSYKIFDSPRGALISGMAVSMILCLRSSLLATENAASCLQRLLNFPEK 414

  Fly   652 VMDGCVLESQKMYEATPKSITHRQHALRL 680
            :....::|..|..:........|..||.:
plant   415 IDVRKIIEKAKSLQTLALDDDVRSSALSI 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 57/331 (17%)
RHOD_Kc 706..810 CDD:238783
AT4G29950NP_567836.2 TBC <101..353 CDD:214540 46/254 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.