DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and CG5916

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001287357.1 Gene:CG5916 / 41960 FlyBaseID:FBgn0038401 Length:330 Species:Drosophila melanogaster


Alignment Length:257 Identity:58/257 - (22%)
Similarity:99/257 - (38%) Gaps:69/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 EYQFQR-----VRLFARLLQGYPHTA---------------------EQLQREAAVDVPPLLRGP 439
            ||.|:|     ...:::.:.||..|.                     .:|:|.....:|...|..
  Fly    14 EYGFKRGDHFDYNNYSKFMDGYLKTLTRRRMKWEAILQQNTDLTQVDAKLKRYIRKGIPGPYRPD 78

  Fly   440 IW-------AA----------LLEVVPNGSYAKIDKFTSTSTDRQIEVDIPRCHQYDELLSSPDG 487
            :|       ||          ||...|      .||..|.|    |.:|:||        :.||.
  Fly    79 VWMKISGAAAAQRRSPDLFRNLLRTEP------FDKEISDS----ISIDLPR--------TFPDN 125

  Fly   488 ------HRKLRRLLKAWVTAHPQYVYWQGLDSLTAPFLYLNFNNEELAFLSLFKFIPKYLQWFFL 546
                  .::|..:|.|:...:....|.|||:.: |..|.:..::||.:|. |.|.|.:.:...:.
  Fly   126 IHFDMKKQRLYNILIAYAHHNRDVGYCQGLNYI-AGLLLIVTDDEEKSFW-LLKHIVENIVPQYH 188

  Fly   547 KDNSAVIKEYLSKFSQLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWD 608
            ..|.|.:...|:.|.:|.....|.:.:|:.::.....:.|..||:.:|:.|.|:..:|.:||
  Fly   189 SHNMANLLRDLAVFRELVIRRIPAVNRHVDNLGLPYPVIASKWFICIFAEVLPVETVLRIWD 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 49/200 (25%)
RHOD_Kc 706..810 CDD:238783
CG5916NP_001287357.1 TBC 67..276 CDD:214540 49/204 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456523
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.