DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and CG7324

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_649305.1 Gene:CG7324 / 40361 FlyBaseID:FBgn0037074 Length:1291 Species:Drosophila melanogaster


Alignment Length:468 Identity:106/468 - (22%)
Similarity:180/468 - (38%) Gaps:96/468 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 DRVVPLRLKALLQRLSGLPAAVYFPLLHS---------------PRFPAHFAREL---QELPLVI 395
            ||.|      |:.:::.|.|.|:.||...               ..|...|:.|:   ||     
  Fly   377 DRAV------LISKITDLLARVHVPLSRERAKYDISWSKQTALMNTFKTQFSAEIIQKQE----- 430

  Fly   396 REKDIEYQFQRVRLFARLLQGYPHTAEQLQREAAVDVPPLLRGPIWAALLEVVPN-----GSYAK 455
             ||.:.:: ...|.|.|.: |...|.:.:.. ....:|..||..||......:.:     |.|..
  Fly   431 -EKMVRWE-AHFRDFGRGI-GMFRTTDVINL-IVEGIPDKLRQEIWLIFSGAIHDKEMNPGLYED 491

  Fly   456 -IDK-------FTSTSTDRQIEVDIPRCHQYDELLSSPDGHRKLRRLLKAWVTAHPQYVYWQGLD 512
             ::|       |.....||    |:||.........|.||...|||:|:|:...:||..|.|.::
  Fly   492 LVEKAACIKNCFAHDEIDR----DLPRSLPEHPAFQSTDGIGALRRVLQAYALRNPQVGYCQAMN 552

  Fly   513 SLTAPFLYLNFNNEELAFLSLFKFIPKYLQWFFLKDNSAVIKEYLSKFSQLTAFHEPLLAQHLAS 577
            .:::.||.  |.:||.||..|.......|..:: ||.....:......::|...|.|.|..||..
  Fly   553 IVSSVFLL--FCDEENAFWMLASLCENLLPDYY-KDKVVGAQIDQGVLNELVETHLPDLHGHLEQ 614

  Fly   578 ISFIPELFAIPWFLTMFSHVFPLHKILHLWDKLMLGDSSYPLFIGIAILRQLRSTLL-TSGFNEC 641
            :..| ::.:|.||||:|..|......||:.|......:.....|.:.|:...|..|| .....|.
  Fly   615 LGVI-KMISISWFLTIFMSVISYESSLHILDCFFYEGAKIIFMISLQIIEWNRDKLLICQDDGEA 678

  Fly   642 ILLFSDLPDIVMDGCVLESQKMYEATPKSITHRQHALRLQPPQAL----------DI---GVADV 693
            :|:..:    .::|......::...|.|....|:  ::.|..|.|          ||   .:.::
  Fly   679 MLVLQN----YLEGVYNPEYQVPPTTDKRKMERK--VQTQTVQTLIHEAYTKFGEDITQQRIEEL 737

  Fly   694 ELKHLQQEQCPRISAKDVQFLLDNSPAELALIDLRSVVEFGRVHVPH----SINIPFATVQLGEQ 754
            ..||      .|::.:  ||.:||.         :::|: ..|..|:    .:::....::..:.
  Fly   738 RNKH------RRLTMR--QFDIDNE---------KTIVK-AYVQNPYFNRSELHMLLTIIREEKH 784

  Fly   755 RLEALQVPQLEAQ 767
            .|::||..|.:.|
  Fly   785 ALKSLQQQQQKVQ 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 57/214 (27%)
RHOD_Kc 706..810 CDD:238783 12/66 (18%)
CG7324NP_649305.1 PH-GRAM1_TCB1D8_TCB1D9_family 147..249 CDD:275404
PH-GRAM2_TCB1D9_TCB1D9B 293..389 CDD:270161 4/17 (24%)
TBC 462..670 CDD:214540 57/215 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.