DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and GAPsec

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster


Alignment Length:284 Identity:59/284 - (20%)
Similarity:103/284 - (36%) Gaps:69/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 PLLRGP--IWAALLEVVPNGSYAKIDK----------FTSTSTDRQIEVDI-------PRCHQ-- 477
            ||..||  .|.....  .|....:|||          |....||...|:.:       .|.|:  
  Fly   110 PLSEGPESAWNTFFN--DNEFLLQIDKDVRRLCPDISFFQQPTDYPCEIVVHSKGEHGRRLHERV 172

  Fly   478 YDELLSSPDGHRK-------------------------------LRRLLKAWVTAHPQYVYWQGL 511
            ...:|||.:..||                               ::|:|..:...:|...|.||:
  Fly   173 VPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAHWEVVQRILFIYAKLNPGQGYVQGM 237

  Fly   512 DSLTAPFLYLNFNNEELAFLS--------LFKFIPKYLQWFFLK---DNSAVIKEYLSKFSQLTA 565
            :.:..|..|:..::.:|.:.:        .|..:...::.||:|   |....||..:::.|.:..
  Fly   238 NEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMSEIRDFFIKTLDDAEGGIKFMMARLSNMLK 302

  Fly   566 FHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWDKLMLGDSSYPLFIGIA---ILR 627
            ..:..:.:.|.|....|:.::..|...:.|..|||..:|.:||.:...:..:...|.|.   ||.
  Fly   303 SKDLSIYELLRSQELHPQYYSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILI 367

  Fly   628 QLRSTLLTSGFNECILLFSDLPDI 651
            | |..:|.:.|...:.|..:.|.|
  Fly   368 Q-REAILENDFASNVKLLQNYPPI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 54/265 (20%)
RHOD_Kc 706..810 CDD:238783
GAPsecNP_648245.2 TBC <191..373 CDD:214540 34/182 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.