DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and RN-tre

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster


Alignment Length:289 Identity:73/289 - (25%)
Similarity:124/289 - (42%) Gaps:51/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 FPLLHSPRFPAHFARELQELPLVIREKDIEYQFQRVRLFARLLQGYPHTAEQLQREAAVDVPPLL 436
            :..||..|.|:  .|:.||   |.|.|   .:.:|.:.:.::|..:|...::|.:.....:|..:
  Fly    52 YGFLHDSRLPS--TRDAQE---VHRNK---IEMERDKKWMKMLNQWPPPQDKLHKRVYKGIPDRV 108

  Fly   437 RGPIWAALLEVVPN-----GSYAKIDKFT---STSTDRQIEVDIPRCHQYDELLSSPDGHR---- 489
            |...|..||::..:     |.|.::.:..   ||.| |||:.|:.|  |:.:.|:..:.:.    
  Fly   109 RMVAWNKLLDIQQSINNNAGVYLRMLQLARKYSTET-RQIDADVNR--QFRDNLAFRERYSVKQC 170

  Fly   490 KLRRLLKAWVTAHPQYVYWQGLDSLTAP-FLYLNFNNEELAFLSLFKFI--PKY-LQWFFLKDNS 550
            .|..:|.|:...:.:..|.||:..:... .|||   :||.||.:|...|  .|| :...|::.  
  Fly   171 SLFNVLNAYSIYNSELGYCQGMACVAGVLLLYL---HEEEAFWALNTLITDQKYGMHGLFIEG-- 230

  Fly   551 AVIKEYLSKFSQLTAF---HEPLLA-------QHLASISFIPELFAIPWFLTMFSHVFPLHKILH 605
                     |.:||.|   |:.:::       :|....:....|:||.||..:|....|....|.
  Fly   231 ---------FPKLTRFIDHHDRIMSKIMRKLHKHFTKHNVDALLYAIKWFFVVFVERVPFSLSLR 286

  Fly   606 LWDKLMLGDSSYPLFIGIAILRQLRSTLL 634
            :||..||......|.:.|.||...:..||
  Fly   287 VWDIFMLDGDRVILSMAITILYLHKDELL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 57/227 (25%)
RHOD_Kc 706..810 CDD:238783
RN-treNP_652381.1 TBC 100..315 CDD:214540 57/231 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456519
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.