DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and tbc

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_001285494.1 Gene:tbc / 318059 FlyBaseID:FBgn0052506 Length:1155 Species:Drosophila melanogaster


Alignment Length:195 Identity:41/195 - (21%)
Similarity:82/195 - (42%) Gaps:20/195 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 QIEVDIPRCHQ-----YDELLSSPDGHRKLRRLLKAWVTAHPQYVYWQGLDSLTAPFLYLNFNNE 526
            :||.|:.||.:     .:|.|.      |||.::..:|..|....|.||:..|.||.|.: |::|
  Fly   945 RIEKDVQRCDRNYWYFANENLD------KLRNVISTYVWEHLDVGYMQGMCDLVAPLLVI-FDDE 1002

  Fly   527 ELAFLSLFKFIPKYLQWFFLKDNSAVIKEYLSKFSQLTAFHEPLLAQHLASISFIPELFAIPWFL 591
            .|::....|.:.:.::.|  ....|:...:.:..|.:......:.....::..:....|...|||
  Fly  1003 SLSYSCFCKLMERMIENF--PSGGAMDMHFANMRSLIQILDSEMYDLMDSNGDYTHFYFCYRWFL 1065

  Fly   592 TMFSHVFPLHKILHLWDKLM----LGDSSYPLFIGIAILRQLRSTLLTSG--FNECILLFSDLPD 650
            ..|........:...|:.:.    :....:.||:.:|:|...|..:|::.  |.:.|..|:::.:
  Fly  1066 LDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLETYRDIILSNSMDFTDVIKFFNEMAE 1130

  Fly   651  650
              Fly  1131  1130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 37/175 (21%)
RHOD_Kc 706..810 CDD:238783
tbcNP_001285494.1 RUN 45..218 CDD:280855
PH_RUTBC 292..466 CDD:275431
TBC 923..1087 CDD:214540 32/150 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456520
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.