DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4041 and cdc16

DIOPT Version :9

Sequence 1:NP_572197.4 Gene:CG4041 / 31422 FlyBaseID:FBgn0029736 Length:819 Species:Drosophila melanogaster
Sequence 2:NP_593901.1 Gene:cdc16 / 2542162 PomBaseID:SPAC6F6.08c Length:299 Species:Schizosaccharomyces pombe


Alignment Length:199 Identity:50/199 - (25%)
Similarity:90/199 - (45%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 IWAALLEVVPNGS--YAKIDKFTSTSTDRQIEVDIPRCHQYDELLSSPDGHRKLRRLLKAWVTAH 502
            :||.||...|..:  |.:..:...:...::|:.|:.|....:....|......|.|||.|:|...
pombe    50 VWAVLLNAPPRNADEYIRYVRQGPSPMAQKIQNDVSRTLVVESQFHSRVSQSSLSRLLNAYVWKR 114

  Fly   503 PQYVYWQGLDSLTAPFLYLNFNNEELAFLSLFKFIPKYLQ----WFFLKDNSAVIK--EYLSKFS 561
            .. :|.||::.|.:||||. ..:|..|    |:|..:.||    .:.|.:...|.:  :.|.|..
pombe   115 GA-LYVQGMNVLASPFLYA-CKSENQA----FQFFDRLLQNECPLYVLPNIDGVHRGAKLLDKCL 173

  Fly   562 QLTAFHEPLLAQHLASISFIPELFAIPWFLTMFSHVFPLHKILHLWDKLMLGDSSYPLFIGI-AI 625
            ::.   :..|..:|.|.....:::|:|..||:.:...||.:.|.:||.|.    :|.:.:.| .:
pombe   174 EVL---DHRLYTYLLSKGLTAKIYALPSILTLSACTAPLSEALTIWDFLF----AYGIHLNILCV 231

  Fly   626 LRQL 629
            :.|:
pombe   232 IAQM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4041NP_572197.4 PKc_like 45..272 CDD:304357
TBC 432..634 CDD:214540 50/199 (25%)
RHOD_Kc 706..810 CDD:238783
cdc16NP_593901.1 COG5210 <1..299 CDD:227535 50/199 (25%)
TBC 38..244 CDD:214540 50/199 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3699
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.