| Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_115540.2 | Gene: | ZNF394 / 84124 | HGNCID: | 18832 | Length: | 561 | Species: | Homo sapiens |
| Alignment Length: | 335 | Identity: | 99/335 - (29%) |
|---|---|---|---|
| Similarity: | 155/335 - (46%) | Gaps: | 58/335 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 68 STASSSDSDAIAQQQ------QHQNPQQQQHQNS----------QQQQQQQQQMQSSSSSENL-- 114
Fly 115 -------QSQDDSEDVDLIFNEEGSCPLCNKTFS------------------RKSSLMTHIRNHS 154
Fly 155 AERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNE 219
Fly 220 PECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFK 284
Fly 285 LQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH-DEFKFKCDICPSSFNQESLLKKHV 348
Fly 349 QRHVEGRYLS 358 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 85/254 (33%) |
| C2H2 Zn finger | 133..153 | CDD:275368 | 6/37 (16%) | ||
| zf-H2C2_2 | 145..170 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 161..181 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 173..198 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 217..239 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 231..256 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 247..267 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 275..296 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 304..324 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 331..351 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 359..380 | CDD:275368 | 99/335 (30%) | ||
| ZNF394 | NP_115540.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..61 | ||
| SCAN | 60..170 | CDD:128708 | |||
| KRAB_A-box | 155..214 | CDD:322003 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 182..201 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 231..285 | 7/51 (14%) | |||
| C2H2 Zn finger | 337..353 | CDD:275368 | 4/15 (27%) | ||
| COG5048 | 356..>420 | CDD:227381 | 29/65 (45%) | ||
| C2H2 Zn finger | 360..380 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 388..408 | CDD:275368 | 9/19 (47%) | ||
| zf-C2H2 | 414..436 | CDD:306579 | 8/23 (35%) | ||
| C2H2 Zn finger | 416..436 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 444..463 | CDD:275368 | 4/19 (21%) | ||
| SFP1 | <464..543 | CDD:227516 | 29/79 (37%) | ||
| C2H2 Zn finger | 471..491 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 499..519 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 527..547 | CDD:275368 | 8/20 (40%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23226 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||