DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and JKD

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_195935.2 Gene:JKD / 831919 AraportID:AT5G03150 Length:503 Species:Arabidopsis thaliana


Alignment Length:468 Identity:104/468 - (22%)
Similarity:157/468 - (33%) Gaps:128/468 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SSDSDAIAQQQQHQNPQQQQ----HQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGS 132
            ||.......|:.|.:..|||    :.||......:....|:....|.....| .|.|:|    ..
plant    12 SSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNAKPNSSSAKKKRNQPGTPD-PDADVI----AL 71

  Fly   133 CPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHT-----NDRPYQ---- 188
            .|         ::||       |..:|||..|:|||.:..||:.|.|.|.     ..|..|    
plant    72 SP---------TTLM-------ATNRFVCEICNKGFQRDQNLQLHRRGHNLPWKLKQRSKQEVIK 120

  Fly   189 ----------CV--DCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHK 241
                      ||  |..:....:|.:..|.....||:.:.|.  :|.:.:|    :.:..|:|.|
plant   121 KKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCE--KCSKKYA----VQSDWKAHAK 179

  Fly   242 ---VQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTH--MKTHGLAFP 301
               .::|.|: |...|::..|...|..        :|....|:..::.|..:.:  :.|..|.|.
plant   180 TCGTREYKCD-CGTLFSRKDSFITHRA--------FCDALTEEGARMSSLSNNNPVISTTNLNFG 235

  Fly   302 YECDKCDEKFLQQAHLDQHLKMHDEFKFKCDICPSSFNQESLLKKH--VQRHVEGRYLSCPVANC 364
            .|.:..:...|....:  |..:|..     || .::.:|..|...|  ...|.:|......:|:.
plant   236 NESNVMNNPNLPHGFV--HRGVHHP-----DI-NAAISQFGLGFGHDLSAMHAQGLSEMVQMAST 292

  Fly   365 AESFAVRQHL----SKHLLTNHAHHELPPPKRSKKAG-TL---QTSQQPLAMIGQPLSLQHTT-- 419
            .     ..||    |..|.....||:...|..|.... ||   .||||..|      ||||.|  
plant   293 G-----NHHLFPSSSSSLPDFSGHHQFQIPMTSTNPSLTLSSSSTSQQTSA------SLQHQTLK 346

  Fly   420 ------------GQRGRPPKNKNKATTLAATAIKIEINESLHSQHISNVSG-------------- 458
                        ..:...|.:...||.|...|.::....|..|...|..:|              
plant   347 DSSFSPLFSSSSENKQNKPLSPMSATALLQKAAQMGSTRSNSSTAPSFFAGPTMTSSSATASPPP 411

  Fly   459 -----LSIQQQIN 466
                 :.||||:|
plant   412 RSSSPMMIQQQLN 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 60/285 (21%)
C2H2 Zn finger 133..153 CDD:275368 3/19 (16%)
zf-H2C2_2 145..170 CDD:290200 10/24 (42%)
C2H2 Zn finger 161..181 CDD:275368 9/19 (47%)
zf-H2C2_2 173..198 CDD:290200 10/45 (22%)
C2H2 Zn finger 189..209 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..239 CDD:275368 4/21 (19%)
zf-H2C2_2 231..256 CDD:290200 7/27 (26%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
C2H2 Zn finger 275..296 CDD:275368 3/22 (14%)
C2H2 Zn finger 304..324 CDD:275368 2/19 (11%)
C2H2 Zn finger 331..351 CDD:275368 5/21 (24%)
C2H2 Zn finger 359..380 CDD:275368 5/24 (21%)
JKDNP_195935.2 C2H2 Zn finger 84..104 CDD:275368 9/19 (47%)
C2H2 Zn finger 126..154 CDD:275368 5/27 (19%)
C2H2 Zn finger 161..180 CDD:275368 5/24 (21%)
C2H2 Zn finger 188..204 CDD:275368 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.