DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and IDD2

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_190639.1 Gene:IDD2 / 824234 AraportID:AT3G50700 Length:452 Species:Arabidopsis thaliana


Alignment Length:477 Identity:102/477 - (21%)
Similarity:159/477 - (33%) Gaps:170/477 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SSSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEE 130
            :|||.|...|.:|: ...:|||.    .||           :.....||....|.|. ::|    
plant     7 NSSTVSGEASVSIS-STGNQNPL----PNS-----------TGKKKRNLPGMPDPES-EVI---- 50

  Fly   131 GSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKT 195
                    ..|.|:.|.|:        :|||..|:|||.:..||:.|.|.|  :.|::       
plant    51 --------ALSPKTLLATN--------RFVCEICNKGFQRDQNLQLHRRGH--NLPWK------- 90

  Fly   196 FTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSL 260
                  |.........::.:||.|..|               .||..        ::....:|.:
plant    91 ------LRQKSNKEVKKKVYVCPEVSC---------------VHHDP--------SRALGDLTGI 126

  Fly   261 NQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMHD 325
            .:|          :|.:..||.:|                   ||||.:|:..|:....|.|:..
plant   127 KKH----------FCRKHGEKKWK-------------------CDKCSKKYAVQSDWKAHSKICG 162

  Fly   326 EFKFKCDICPSSFNQESLLKKHVQRHVEGRYLSCPVANC---AESFAVRQHLSK------HLLT- 380
            ..::||| |.:.|::......|             .|.|   ||..| |.|.|:      .:|| 
plant   163 TKEYKCD-CGTLFSRRDSFITH-------------RAFCDALAEENA-RSHHSQSKKQNPEILTR 212

  Fly   381 -NHAHHELPPPK-------RSKKAGTLQTSQQP------LAMIGQPLSLQHTTG---------QR 422
             |...:.:|.|.       :|....|::.|:.|      :....:|.||...|.         ..
plant   213 KNPVPNPVPAPVDTESAKIKSSSTLTIKQSESPKTPPEIVQEAPKPTSLNVVTSNGVFAGLFESS 277

  Fly   423 GRPPK---NKNKATTLAATAIKIE-INESLHSQHISNVSGLSIQQQINQHMQQQAAQQQAQQQAA 483
            ...|.   ..:.:.:|.|::..|| |:..|.:.|.|:..| |.:......|...|..|:|.|..|
plant   278 SASPSIYTTSSSSKSLFASSSSIEPISLGLSTSHGSSFLG-SNRFHAQPAMSATALLQKAAQMGA 341

  Fly   484 QQQQQQAAQQQQQAAQQQQLLH 505
                         |:....|||
plant   342 -------------ASSGGSLLH 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 53/262 (20%)
C2H2 Zn finger 133..153 CDD:275368 4/19 (21%)
zf-H2C2_2 145..170 CDD:290200 9/24 (38%)
C2H2 Zn finger 161..181 CDD:275368 9/19 (47%)
zf-H2C2_2 173..198 CDD:290200 6/24 (25%)
C2H2 Zn finger 189..209 CDD:275368 1/19 (5%)
C2H2 Zn finger 217..239 CDD:275368 3/21 (14%)
zf-H2C2_2 231..256 CDD:290200 2/24 (8%)
C2H2 Zn finger 247..267 CDD:275368 2/19 (11%)
C2H2 Zn finger 275..296 CDD:275368 4/20 (20%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
C2H2 Zn finger 359..380 CDD:275368 8/29 (28%)
IDD2NP_190639.1 C2H2 Zn finger 65..85 CDD:275368 9/19 (47%)
C2H2 Zn finger 106..134 CDD:275368 8/60 (13%)
C2H2 Zn finger 141..160 CDD:275368 7/18 (39%)
C2H2 Zn finger 168..184 CDD:275368 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.