Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_084415.1 | Gene: | Zfp449 / 78619 | MGIID: | 1925869 | Length: | 518 | Species: | Mus musculus |
Alignment Length: | 272 | Identity: | 87/272 - (31%) |
---|---|---|---|
Similarity: | 132/272 - (48%) | Gaps: | 32/272 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 QQQQQQQQMQSSSSSENLQSQ-------------DDSEDVDLIFNEEGSCPLCNKTFSRKSSLMT 148
Fly 149 HIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGER 213
Fly 214 PFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRC 278
Fly 279 PEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH-DEFKFKCDICPSSFNQES 342
Fly 343 LLKKHVQRHVEG 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 79/232 (34%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 4/24 (17%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 5/21 (24%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 331..351 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Zfp449 | NP_084415.1 | SCAN | 27..134 | CDD:128708 | |
SCAN | 27..113 | CDD:280241 | |||
COG5048 | <323..483 | CDD:227381 | 58/162 (36%) | ||
zf-C2H2 | 323..345 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 341..362 | CDD:290200 | 10/20 (50%) | ||
C2H2 Zn finger | 353..373 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 365..390 | CDD:290200 | 13/26 (50%) | ||
C2H2 Zn finger | 381..401 | CDD:275368 | 5/21 (24%) | ||
zf-C2H2 | 407..429 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 409..429 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 421..446 | CDD:290200 | 11/25 (44%) | ||
C2H2 Zn finger | 437..457 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 449..474 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 465..485 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 477..502 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 493..513 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |