| Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055334.2 | Gene: | ZNF232 / 7775 | HGNCID: | 13026 | Length: | 444 | Species: | Homo sapiens |
| Alignment Length: | 212 | Identity: | 67/212 - (31%) |
|---|---|---|---|
| Similarity: | 113/212 - (53%) | Gaps: | 30/212 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 ATSSSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFN 128
Fly 129 EE-------GSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRP 186
Fly 187 YQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCN 251
Fly 252 KKFTQVTSLNQHLQAHA 268 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 55/152 (36%) |
| C2H2 Zn finger | 133..153 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 145..170 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 161..181 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 173..198 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 217..239 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 231..256 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 247..267 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 275..296 | CDD:275368 | |||
| C2H2 Zn finger | 304..324 | CDD:275368 | |||
| C2H2 Zn finger | 331..351 | CDD:275368 | |||
| C2H2 Zn finger | 359..380 | CDD:275368 | |||
| ZNF232 | NP_055334.2 | SCAN | 75..188 | CDD:128708 | |
| SCAN | 75..162 | CDD:280241 | |||
| COG5048 | <303..409 | CDD:227381 | 46/107 (43%) | ||
| zf-C2H2 | 303..325 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 305..325 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 317..342 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 333..353 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 345..368 | CDD:290200 | 12/22 (55%) | ||
| C2H2 Zn finger | 361..381 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 373..398 | CDD:290200 | 13/26 (50%) | ||
| COG5048 | 385..>437 | CDD:227381 | 16/53 (30%) | ||
| C2H2 Zn finger | 389..409 | CDD:275368 | 9/21 (43%) | ||
| zf-H2C2_2 | 401..424 | CDD:290200 | 6/22 (27%) | ||
| C2H2 Zn finger | 417..437 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23226 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||