DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZSCAN9

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011513177.1 Gene:ZSCAN9 / 7746 HGNCID:12984 Length:583 Species:Homo sapiens


Alignment Length:138 Identity:53/138 - (38%)
Similarity:85/138 - (61%) Gaps:3/138 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 YQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCN 251
            ::|.:|||:|||.:.|..|:|:||||||:.||  |||::|::.:.|.||...|:..::|.|..|.
Human   443 HKCDECGKSFTQSSGLIRHQRIHTGERPYECN--ECGKAFSRSSGLFNHRGIHNIQKRYHCKECG 505

  Fly   252 KKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAH 316
            |.|:|...|.||.:.|.|...|.|.:| .|::..:|.|..|.::|....|::|.:|.:.|.:..:
Human   506 KVFSQSAGLIQHQRIHKGEKPYQCSQC-SKSYSRRSFLIEHQRSHTGERPHQCIECGKSFNRHCN 569

  Fly   317 LDQHLKMH 324
            |.:|.|:|
Human   570 LIRHQKIH 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 53/138 (38%)
C2H2 Zn finger 133..153 CDD:275368
zf-H2C2_2 145..170 CDD:290200
C2H2 Zn finger 161..181 CDD:275368
zf-H2C2_2 173..198 CDD:290200 5/10 (50%)
C2H2 Zn finger 189..209 CDD:275368 10/19 (53%)
C2H2 Zn finger 217..239 CDD:275368 9/21 (43%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
C2H2 Zn finger 275..296 CDD:275368 6/20 (30%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
ZSCAN9XP_011513177.1 SCAN 180..292 CDD:128708
SCAN 181..268 CDD:280241
COG5048 <442..578 CDD:227381 53/138 (38%)
zf-C2H2 443..465 CDD:278523 10/21 (48%)
C2H2 Zn finger 445..465 CDD:275368 10/19 (53%)
zf-H2C2_2 458..482 CDD:290200 15/25 (60%)
C2H2 Zn finger 473..493 CDD:275368 9/21 (43%)
zf-C2H2 499..521 CDD:278523 9/21 (43%)
C2H2 Zn finger 501..521 CDD:275368 8/19 (42%)
zf-H2C2_2 514..538 CDD:290200 9/24 (38%)
C2H2 Zn finger 529..549 CDD:275368 6/20 (30%)
zf-H2C2_2 542..566 CDD:290200 7/23 (30%)
C2H2 Zn finger 557..577 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.