DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZNF76

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011513148.1 Gene:ZNF76 / 7629 HGNCID:13149 Length:591 Species:Homo sapiens


Alignment Length:430 Identity:111/430 - (25%)
Similarity:163/430 - (37%) Gaps:117/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PLCNKTFSRKSSLMTHIRNHSAERKFVC--TYCHKGFTQAANLRNHERIHTNDRPYQC--VDCGK 194
            |.|.|.|:....|.:|:|.|:.|:.:.|  ..|.|.|..:.:|:.|.|.||.:||:||  ..||:
Human   212 PSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTSGDLQKHVRTHTGERPFQCPFEGCGR 276

  Fly   195 TFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNV--CNKKFTQV 257
            :||.......|.|.||||||:.|.||.|||.|...||..||::.|...:.|.|.|  |.|:||:.
Human   277 SFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSATNYKNHVRIHTGEKPYVCTVPGCGKRFTEY 341

  Fly   258 TSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLK 322
            :||.:|   |.                    :|||.|      ||.|..|.:.:.|.:.|..|.:
Human   342 SSLYKH---HV--------------------VHTHCK------PYTCSTCGKTYRQTSTLAMHKR 377

  Fly   323 -MHDEFKFKCDICPSSFNQESLLKKHVQRHVEGRYLSCPVANCAESFAVRQHLSKHLLTNHAHHE 386
             .|.|.:         ..:||....:.|:.:|       .|:.||                   |
Human   378 SAHGELE---------ATEESEQALYEQQQLE-------AASAAE-------------------E 407

  Fly   387 LPPPKRSKKA----------------------------------GTLQTSQQP--LAMIGQPLSL 415
            .|||||.:.|                                  |..|.|..|  |..:|..:|:
Human   408 SPPPKRPRIAYLSEVKEERDDIPAQVAMVTEEDGAPQVALITQDGAQQVSLSPEDLQALGSAISM 472

  Fly   416 --QHTTGQRGRPPKNKNKATTLAATAIKIEINESLHSQHISNV-SGLSIQQQIN----QHMQQQA 473
              ||.:.....|..:.:.||:...|...:.. :...:|.::.: ||..:.:..:    :|.|...
Human   473 VTQHGSTTLTIPSPDADLATSGTHTVTMVSA-DGTQTQPVTIITSGAVVAEDSSVASLRHQQVAL 536

  Fly   474 AQQQAQQQAAQQQQQQAAQQQQQAAQQ--QQLLHLPMGQA 511
            .........|.|.....:....||...  ...|||.|.:|
Human   537 LATANGTHIAVQDNSDGSPPVVQALHHFVSLFLHLEMKEA 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 77/250 (31%)
C2H2 Zn finger 133..153 CDD:275368 7/18 (39%)
zf-H2C2_2 145..170 CDD:290200 9/26 (35%)
C2H2 Zn finger 161..181 CDD:275368 7/21 (33%)
zf-H2C2_2 173..198 CDD:290200 12/26 (46%)
C2H2 Zn finger 189..209 CDD:275368 7/21 (33%)
C2H2 Zn finger 217..239 CDD:275368 11/21 (52%)
zf-H2C2_2 231..256 CDD:290200 10/26 (38%)
C2H2 Zn finger 247..267 CDD:275368 9/21 (43%)
C2H2 Zn finger 275..296 CDD:275368 4/20 (20%)
C2H2 Zn finger 304..324 CDD:275368 5/20 (25%)
C2H2 Zn finger 331..351 CDD:275368 3/19 (16%)
C2H2 Zn finger 359..380 CDD:275368 3/20 (15%)
ZNF76XP_011513148.1 C2H2 Zn finger 179..201 CDD:275368
zf-H2C2_2 193..220 CDD:290200 4/7 (57%)
COG5048 204..>262 CDD:227381 16/49 (33%)
C2H2 Zn finger 209..231 CDD:275368 7/18 (39%)
zf-H2C2_2 224..250 CDD:290200 9/25 (36%)
zf-C2H2_aberr 237..358 CDD:293622 53/149 (36%)
C2H2 Zn finger 239..261 CDD:275368 7/21 (33%)
zf-H2C2_2 253..280 CDD:290200 12/26 (46%)
C2H2 Zn finger 269..291 CDD:275368 7/21 (33%)
zf-H2C2_2 285..310 CDD:290200 15/24 (63%)
C2H2 Zn finger 299..321 CDD:275368 11/21 (52%)
zf-H2C2_2 313..339 CDD:290200 9/25 (36%)
C2H2 Zn finger 329..351 CDD:275368 10/44 (23%)
C2H2 Zn finger 359..377 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.