DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZSCAN21

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001349708.1 Gene:ZSCAN21 / 7589 HGNCID:13104 Length:473 Species:Homo sapiens


Alignment Length:359 Identity:96/359 - (26%)
Similarity:155/359 - (43%) Gaps:69/359 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TSSSTASSSDS----------------------DAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQS 107
            :||.||..|.|                      ::..:|:..|:|::.:......|.::....|.
Human   149 SSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQK 213

  Fly   108 SSSSENLQSQ------DDSEDVDL------IFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFV 160
            .|.:|.|:..      .:..:..|      :.||:|:.|...:..|:|.......:....||:::
Human   214 GSEAEGLKGDIISVIIANKPEASLERQCVNLENEKGTKPPLQEAGSKKGRESVPTKPTPGERRYI 278

  Fly   161 CTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRS 225
            |..|.|.|:.::||..|.|.||.::||.|..|||.|:..:||..|.|.|..:||:.|   :||::
Human   279 CAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDC---KCGKA 340

  Fly   226 FAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLH 290
            |.|.::|..|.:.|.:...|.|..|.|.|:...||.:|.:.|.|          ||         
Human   341 FGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTG----------EK--------- 386

  Fly   291 THMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH-DEFKFKCDICPSSFNQESLLKKHVQRHVEG 354
                      ||:|::|.:.|.|.|.|..|.::| .|..:||..|..:||..|...||.:.|...
Human   387 ----------PYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKHHRIHTGE 441

  Fly   355 RYLSCPVANCAESFAVRQHLSKHLLTNHAHHELP 388
            :...|  .:|.::|..:.:||||...:....|.|
Human   442 KPYWC--HHCGKTFCSKSNLSKHQRVHTGEGEAP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 79/260 (30%)
C2H2 Zn finger 133..153 CDD:275368 3/19 (16%)
zf-H2C2_2 145..170 CDD:290200 6/24 (25%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 13/24 (54%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 7/21 (33%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368 2/20 (10%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..380 CDD:275368 7/20 (35%)
ZSCAN21NP_001349708.1 SCAN 42..153 CDD:128708 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 127..169 6/19 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..272 6/27 (22%)
COG5048 <276..453 CDD:227381 66/210 (31%)
C2H2 Zn finger 279..299 CDD:275368 8/19 (42%)
C2H2 Zn finger 307..327 CDD:275368 9/19 (47%)
C2H2 Zn finger 337..354 CDD:275368 6/16 (38%)
C2H2 Zn finger 362..382 CDD:275368 7/19 (37%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
C2H2 Zn finger 446..466 CDD:275368 7/21 (33%)
zf-C2H2 446..466 CDD:395048 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.