DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zkscan14

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_075811.2 Gene:Zkscan14 / 67235 MGIID:1914485 Length:521 Species:Mus musculus


Alignment Length:280 Identity:91/280 - (32%)
Similarity:138/280 - (49%) Gaps:18/280 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSR 142
            |...::.::.:..:.:||......|....:.....|.|..||        :::|....|:.....
Mouse   249 IGVSREERDSKNNESENSGSSVLGQHIQTAEGLGTNSQCGDD--------HKQGFHVKCHSVKPH 305

  Fly   143 KS-----SLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNL 202
            .|     .|:...|....::.:.|..|.|||.|.::|..|:||||.::||||.:|||.|:|...|
Mouse   306 SSVDSAVGLLETQRQFQEDKPYKCDSCEKGFRQRSDLFKHQRIHTGEKPYQCQECGKRFSQSAAL 370

  Fly   203 NNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAH 267
            ..|:|.||||:|:.|  ||||..|.|.::|:.|.::|...:.|.|..|. :...|:||.:|.:.|
Mouse   371 VKHQRTHTGEKPYAC--PECGECFRQSSHLSRHQRTHASEKYYKCEECG-EIVHVSSLFRHQRLH 432

  Fly   268 AGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH-DEFKFKC 331
            .|...|.|..| ||:|:.:|.|..|.:||....||.|..|..:|.|.|.|.:|.:.| .|..:||
Mouse   433 RGERPYKCGDC-EKSFRQRSDLFKHQRTHTGEKPYACVVCGRRFSQSATLIKHQRTHTGEKPYKC 496

  Fly   332 DICPSSFNQESLLKKHVQRH 351
            ..|...|.|.:.|.:|.:.|
Mouse   497 FQCGERFRQSTHLVRHQRIH 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 83/234 (35%)
C2H2 Zn finger 133..153 CDD:275368 4/24 (17%)
zf-H2C2_2 145..170 CDD:290200 7/24 (29%)
C2H2 Zn finger 161..181 CDD:275368 9/19 (47%)
zf-H2C2_2 173..198 CDD:290200 14/24 (58%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 9/21 (43%)
zf-H2C2_2 231..256 CDD:290200 6/24 (25%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 275..296 CDD:275368 8/20 (40%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..380 CDD:275368
Zkscan14NP_075811.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45
SCAN 40..151 CDD:128708
SCAN 40..128 CDD:280241
KRAB 135..193 CDD:214630
KRAB_A-box 135..173 CDD:143639
COG5048 <303..484 CDD:227381 70/184 (38%)
zf-C2H2 327..349 CDD:278523 9/21 (43%)
C2H2 Zn finger 329..349 CDD:275368 9/19 (47%)
zf-H2C2_2 341..366 CDD:290200 14/24 (58%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
zf-H2C2_2 369..394 CDD:290200 14/26 (54%)
C2H2 Zn finger 385..405 CDD:275368 9/21 (43%)
zf-H2C2_2 424..449 CDD:290200 11/25 (44%)
zf-C2H2 438..460 CDD:278523 9/22 (41%)
C2H2 Zn finger 440..460 CDD:275368 8/20 (40%)
zf-H2C2_2 452..477 CDD:290200 9/24 (38%)
COG5048 464..>521 CDD:227381 19/53 (36%)
C2H2 Zn finger 468..488 CDD:275368 7/19 (37%)
zf-H2C2_2 481..505 CDD:290200 8/23 (35%)
C2H2 Zn finger 496..516 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.