Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001139014.1 | Gene: | ZSCAN18 / 65982 | HGNCID: | 21037 | Length: | 566 | Species: | Homo sapiens |
Alignment Length: | 270 | Identity: | 52/270 - (19%) |
---|---|---|---|
Similarity: | 82/270 - (30%) | Gaps: | 89/270 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 SASAAVAASAAAAATSSSTASSSDSDAIA----------QQQQHQNPQQQQHQNSQQQQQQQQQM 105
Fly 106 QS-------------------------SSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSS 145
Fly 146 LMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHT 210
Fly 211 GERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAG-----V 270
Fly 271 TGYYCPRCPE 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 32/162 (20%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 1/24 (4%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 1/19 (5%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 6/21 (29%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 1/19 (5%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | 3/6 (50%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
ZSCAN18 | NP_001139014.1 | SCAN | 102..189 | CDD:280241 | |
KRAB | <284..321 | CDD:214630 | |||
C2H2 Zn finger | 471..491 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 499..519 | CDD:275368 | 6/21 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |