DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zfp24

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001344376.1 Gene:Zfp24 / 59057 MGIID:1929704 Length:368 Species:Mus musculus


Alignment Length:108 Identity:47/108 - (43%)
Similarity:76/108 - (70%) Gaps:2/108 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 CPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFT 197
            |..|.|.||:.|:|:.|.|.||.|:.:.|..|.|.|::::.|..|:|:||.::||:|::|||.|:
Mouse   253 CDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFS 317

  Fly   198 QITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHH 240
            |.:.|.||:|:||||:|:.|  .:||:|::|.:||..|.:.|:
Mouse   318 QNSGLINHQRIHTGEKPYEC--VQCGKSYSQSSNLFRHQRRHN 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 47/108 (44%)
C2H2 Zn finger 133..153 CDD:275368 9/19 (47%)
zf-H2C2_2 145..170 CDD:290200 10/24 (42%)
C2H2 Zn finger 161..181 CDD:275368 7/19 (37%)
zf-H2C2_2 173..198 CDD:290200 12/24 (50%)
C2H2 Zn finger 189..209 CDD:275368 10/19 (53%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 4/10 (40%)
C2H2 Zn finger 247..267 CDD:275368
C2H2 Zn finger 275..296 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
Zfp24NP_001344376.1 SCAN 48..159 CDD:128708
COG5048 <249..329 CDD:227381 33/75 (44%)
Necessary and sufficient for nuclear localization. /evidence=ECO:0000250 251..301 19/47 (40%)
C2H2 Zn finger 253..273 CDD:275368 9/19 (47%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
COG5048 305..>358 CDD:227381 25/54 (46%)
C2H2 Zn finger 309..329 CDD:275368 10/19 (53%)
C2H2 Zn finger 337..357 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.