DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and OVOL2

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_067043.2 Gene:OVOL2 / 58495 HGNCID:15804 Length:275 Species:Homo sapiens


Alignment Length:236 Identity:58/236 - (24%)
Similarity:108/236 - (45%) Gaps:40/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AASASAAVAASAAAAATSSSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSEN 113
            ::|.|.:.:|.....|.|||:..:.:|:. .:....:.|  ..|..::|:...:.:::.::.:.:
Human    53 SSSGSGSSSAGEPGGAESSSSPHAPESET-PEPGDAEGP--DGHLATKQRPVARSKIKFTTGTCS 114

  Fly   114 LQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHE 178
                      |.:.:   ||.||.|.|..:..|..|::.|:..::.:||:|.|||....:|:.|.
Human   115 ----------DSVVH---SCDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHV 166

  Fly   179 RIHTNDRPYQCVDCGKTFTQITNLNNH-RRLH----------TGERPFVCNEPECGRSFAQVTNL 232
            |.||..|||:|..|.|.|||..:|.:| :::|          ..::.:||.  :||.:.....:|
Human   167 RTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCE--DCGYTGPTQEDL 229

  Fly   233 NNHMKSHH-------KVQQYCCNVCNKKFTQV----TSLNQ 262
            ..|:.|.|       |..:....:...|.|..    |||::
Human   230 YLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 47/161 (29%)
C2H2 Zn finger 133..153 CDD:275368 7/19 (37%)
zf-H2C2_2 145..170 CDD:290200 9/24 (38%)
C2H2 Zn finger 161..181 CDD:275368 9/19 (47%)
zf-H2C2_2 173..198 CDD:290200 12/24 (50%)
C2H2 Zn finger 189..209 CDD:275368 8/20 (40%)
C2H2 Zn finger 217..239 CDD:275368 5/21 (24%)
zf-H2C2_2 231..256 CDD:290200 6/31 (19%)
C2H2 Zn finger 247..267 CDD:275368 5/20 (25%)
C2H2 Zn finger 275..296 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
OVOL2NP_067043.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 15..101 11/50 (22%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
C2H2 Zn finger 149..169 CDD:275368 9/19 (47%)
zf-H2C2_2 161..186 CDD:316026 12/24 (50%)
C2H2 Zn finger 177..198 CDD:275368 8/20 (40%)
C2H2 Zn finger 216..233 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.