DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZSCAN32

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001271456.1 Gene:ZSCAN32 / 54925 HGNCID:20812 Length:697 Species:Homo sapiens


Alignment Length:259 Identity:79/259 - (30%)
Similarity:120/259 - (46%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQM--QSSSSSENLQSQDDSEDVD------LIFNEE 130
            :|:..:::|...:|.:.:.:...|::...|..  :..:.:..|..::.|:.|.      |...:.
Human   456 ESEPTSRRQCRNSPGESEEKTPSQEKMSHQSFCARDKACTHILCGKNCSQSVHSPHKPALKLEKV 520

  Fly   131 GSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKT 195
            ..||.|.|||||.|.|:.|.|.|:.|:...|:.|.|||::.:||..|.|.||.:|||||..|||:
Human   521 SQCPECGKTFSRSSYLVRHQRIHTGEKPHKCSECGKGFSERSNLTAHLRTHTGERPYQCGQCGKS 585

  Fly   196 FTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSL 260
            |.|.::|..|:|.||||:|                              |.|.||.|:|...:..
Human   586 FNQSSSLIVHQRTHTGEKP------------------------------YQCIVCGKRFNNSSQF 620

  Fly   261 NQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH 324
            :.|.:.|.|.:.|.|..| .|.|...|....|.|||....||.|..|:..|.:.:.|.:|..:|
Human   621 SAHRRIHTGESPYKCAVC-GKIFNNSSHFSAHRKTHTGEKPYRCSHCERGFTKNSALTRHQTVH 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 71/207 (34%)
C2H2 Zn finger 133..153 CDD:275368 12/19 (63%)
zf-H2C2_2 145..170 CDD:290200 10/24 (42%)
C2H2 Zn finger 161..181 CDD:275368 9/19 (47%)
zf-H2C2_2 173..198 CDD:290200 15/24 (63%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 0/21 (0%)
zf-H2C2_2 231..256 CDD:290200 6/24 (25%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 275..296 CDD:275368 7/20 (35%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
ZSCAN32NP_001271456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SCAN 33..142 CDD:128708
SCAN 33..121 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..177
KRAB_A-box 218..250 CDD:295379
Myb_DNA-bind_4 253..334 CDD:290549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..482 4/25 (16%)
COG5048 <455..668 CDD:227381 75/242 (31%)
zf-C2H2 522..543 CDD:278523 12/20 (60%)
C2H2 Zn finger 523..543 CDD:275368 12/19 (63%)
zf-H2C2_2 535..559 CDD:290200 9/23 (39%)
C2H2 Zn finger 551..571 CDD:275368 9/19 (47%)
zf-H2C2_2 563..588 CDD:290200 15/24 (63%)
C2H2 Zn finger 579..599 CDD:275368 9/19 (47%)
zf-H2C2_2 591..616 CDD:290200 14/54 (26%)
C2H2 Zn finger 607..627 CDD:275368 6/19 (32%)
zf-H2C2_2 623..644 CDD:290200 8/21 (38%)
C2H2 Zn finger 635..655 CDD:275368 7/20 (35%)
zf-H2C2_2 647..671 CDD:290200 8/23 (35%)
zf-C2H2 661..683 CDD:278523 6/21 (29%)
C2H2 Zn finger 663..683 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.