DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zkscan4

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001034204.1 Gene:Zkscan4 / 544922 MGIID:3649412 Length:480 Species:Mus musculus


Alignment Length:326 Identity:95/326 - (29%)
Similarity:156/326 - (47%) Gaps:33/326 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 AAATSSSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQ-QQQQQQMQSSSSSENLQSQDDSEDVDL 125
            |..|.|..:.||...|:....:|::.:..:....|.: .:.:.:.:....:|..:.|...:.|..
Mouse   155 AVVTPSQDSQSSHCQAMKSLFKHESQESLECSPLQARGLEMKPETRDLPRAEEYRDQKPEQTVCF 219

  Fly   126 IFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCV 190
            :..:....|...:...::..|.|..::.:..|:..|..|.|.|.|::.|..|:||||.::||:|.
Mouse   220 LGEDTVPIPTGAEASEQEGKLQTAQKSATGTRRHFCCECGKSFAQSSGLTKHKRIHTGEKPYECE 284

  Fly   191 DCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFT 255
            ||||||...:.|..|:|:||||:|:.|.  |||:.|:..:||..|.::|...:.|.|:.|.|.||
Mouse   285 DCGKTFIGSSALVIHQRVHTGEKPYECE--ECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFT 347

  Fly   256 QVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHG----------------------- 297
            |..||.:|.:.|.|...:.|..| .|.|:..|.|..|.:.||                       
Mouse   348 QSCSLLEHHKIHTGEKPFQCNLC-GKAFRRSSHLLRHQRIHGDKTAPKPLHGEAWEGQSPVAGQG 411

  Fly   298 --LAFP--YECDKCDEKFLQQAHLDQHLKMH-DEFKFKCDICPSSFNQESLLKKHVQRHVEGRYL 357
              :..|  |:|.:|:..|.::..|.:|.|:| .|..::||.|...|.:.|.|.:|.:.|| |:.|
Mouse   412 EDVEAPETYQCSECERSFTRRRSLLEHKKIHTGEKPYQCDACGKGFTRTSYLAQHQRSHV-GKKL 475

  Fly   358 S 358
            |
Mouse   476 S 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 84/263 (32%)
C2H2 Zn finger 133..153 CDD:275368 3/19 (16%)
zf-H2C2_2 145..170 CDD:290200 7/24 (29%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 15/24 (63%)
C2H2 Zn finger 189..209 CDD:275368 10/19 (53%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 9/19 (47%)
C2H2 Zn finger 275..296 CDD:275368 7/20 (35%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..380 CDD:275368 95/326 (29%)
Zkscan4NP_001034204.1 SCAN 47..155 CDD:128708 95/326 (29%)
SCAN 47..135 CDD:280241
zf-C2H2 253..275 CDD:278523 8/21 (38%)
C2H2 Zn finger 255..275 CDD:275368 8/19 (42%)
zf-H2C2_2 268..290 CDD:290200 13/21 (62%)
C2H2 Zn finger 283..303 CDD:275368 10/19 (53%)
zf-H2C2_2 295..320 CDD:290200 13/26 (50%)
COG5048 <307..471 CDD:227381 48/166 (29%)
zf-C2H2 309..331 CDD:278523 8/23 (35%)
C2H2 Zn finger 311..331 CDD:275368 8/21 (38%)
zf-H2C2_2 323..348 CDD:290200 9/24 (38%)
C2H2 Zn finger 339..359 CDD:275368 9/19 (47%)
zf-H2C2_2 351..376 CDD:290200 9/25 (36%)
zf-C2H2 365..387 CDD:278523 7/22 (32%)
C2H2 Zn finger 367..387 CDD:275368 7/20 (35%)
C2H2 Zn finger 422..442 CDD:275368 6/19 (32%)
zf-H2C2_2 434..459 CDD:290200 9/24 (38%)
C2H2 Zn finger 450..470 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.