DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zfp213

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001028668.2 Gene:Zfp213 / 449521 MGIID:3053094 Length:468 Species:Mus musculus


Alignment Length:332 Identity:77/332 - (23%)
Similarity:125/332 - (37%) Gaps:95/332 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QTATLFQVPGYSIPTCVR--------CSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATS 66
            ::.:|..:|.|    |.|        ....|..|.....|..||..:...:....|..||.|...
Mouse   211 KSGSLGDIPFY----CSREEWSSLDPAQRNLFWNIKRKNSRDAALGLRPKSQKPPAEEAATALLG 271

  Fly    67 SSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQM-------QSSSSSENLQSQDDSEDVD 124
            .:....|           .||::.:.:..:.:...:..:       :....:...|.|      :
Mouse   272 QTEVPMS-----------WNPEEAETEVWESENPMRTALDPLVGARRGRPPTHRRQFQ------N 319

  Fly   125 LIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQC 189
            |:..:..||..|.|.|...|.|..|.|.|:.|:...|..|.|.|..:::|..|:.:||.::|:.|
Mouse   320 LLAEKPHSCAQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQGVHTGEKPFSC 384

  Fly   190 VDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKF 254
            .:|||:|::...|.:|:|:||||:||.|:  |||:|||                           
Mouse   385 SECGKSFSRSAYLADHQRIHTGEKPFSCS--ECGKSFA--------------------------- 420

  Fly   255 TQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQ 319
                                          |:|.|..|.:.|....|:.|.:||:.|.|:|||..
Mouse   421 ------------------------------LRSYLLDHRRVHTGERPFGCGECDKSFKQRAHLIA 455

  Fly   320 HLKMHDE 326
            |..:|.:
Mouse   456 HQSLHSK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 58/203 (29%)
C2H2 Zn finger 133..153 CDD:275368 8/19 (42%)
zf-H2C2_2 145..170 CDD:290200 9/24 (38%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
zf-H2C2_2 173..198 CDD:290200 10/24 (42%)
C2H2 Zn finger 189..209 CDD:275368 8/19 (42%)
C2H2 Zn finger 217..239 CDD:275368 7/21 (33%)
zf-H2C2_2 231..256 CDD:290200 0/24 (0%)
C2H2 Zn finger 247..267 CDD:275368 0/19 (0%)
C2H2 Zn finger 275..296 CDD:275368 4/20 (20%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
Zfp213NP_001028668.2 SCAN 41..138 CDD:128708
SCAN 41..124 CDD:280241
KRAB_A-box 214..247 CDD:143639 7/36 (19%)
COG5048 <324..461 CDD:227381 56/195 (29%)
C2H2 Zn finger 328..348 CDD:275368 8/19 (42%)
zf-H2C2_2 340..365 CDD:290200 9/24 (38%)
C2H2 Zn finger 356..376 CDD:275368 6/19 (32%)
zf-H2C2_2 368..393 CDD:290200 10/24 (42%)
C2H2 Zn finger 384..404 CDD:275368 8/19 (42%)
zf-H2C2_2 396..420 CDD:290200 14/25 (56%)
C2H2 Zn finger 412..432 CDD:275368 11/78 (14%)
zf-H2C2_2 424..449 CDD:290200 8/24 (33%)
C2H2 Zn finger 440..460 CDD:275368 9/19 (47%)
zf-C2H2 440..460 CDD:278523 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.