Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650862.1 | Gene: | CG4936 / 42393 | FlyBaseID: | FBgn0038768 | Length: | 521 | Species: | Drosophila melanogaster |
Alignment Length: | 288 | Identity: | 70/288 - (24%) |
---|---|---|---|
Similarity: | 107/288 - (37%) | Gaps: | 67/288 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 VPGYSIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTASSSDSDAIAQQ 81
Fly 82 QQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGS-------------- 132
Fly 133 ------CPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVD 191
Fly 192 CGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQ 256
Fly 257 VTSLNQHLQAH-----------AGVTGY 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 49/181 (27%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 5/21 (24%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
CG4936 | NP_650862.1 | zf-AD | 22..95 | CDD:214871 | |
C2H2 Zn finger | 362..382 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 375..399 | CDD:290200 | 8/23 (35%) | ||
COG5048 | 386..>447 | CDD:227381 | 23/60 (38%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 403..426 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 432..455 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 5/21 (24%) | ||
zf-H2C2_2 | 459..481 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 474..494 | CDD:275368 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |