DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and trem

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_650861.1 Gene:trem / 42392 FlyBaseID:FBgn0038767 Length:439 Species:Drosophila melanogaster


Alignment Length:375 Identity:86/375 - (22%)
Similarity:140/375 - (37%) Gaps:88/375 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DTIC-------RLCFQTATLFQVPGYSIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAAS 59
            |.:|       |||::    |::      ||.|..:.:.:..:...|.|.||......|.|...|
  Fly    58 DKMCSKCVRCLRLCYK----FRL------TCQRSHQHIMDMLDREASNANAAGEGDLLSIAEDLS 112

  Fly    60 AAAAATS-SSTASSSDSDAIA---QQQQHQ--------------------NPQQQ---------- 90
            ..:...| ...||..|.....   :.||||                    :|.|.          
  Fly   113 VESVLKSWEDYASQLDGGMKVEGEEDQQHQVITYVVEDGDTDDTNMFDVHDPTQPVPNEIEEAET 177

  Fly    91 ----------QHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPL------CNKT 139
                      .::||.:..|::....:..::|....::.:||:  :.::|...|.      |:: 
  Fly   178 YAEYEEYELLTNENSPEIAQEKGSTGTDVATEEPPEEEIAEDI--LDSDEDYDPTHAKPEKCDR- 239

  Fly   140 FSRKSSLMTHIRNHSAE-------RK-------FVCTYCHKGFTQAANLRNHERIHTNDRPYQCV 190
             |.:..:..|..:...|       ||       ::|..|...:...|.|..|.:.|:..:|::|.
  Fly   240 -SGRKPVAYHKNSPKVETFKKKVGRKPRNKLSTYICDVCGNIYPTQARLTEHMKFHSGVKPHECE 303

  Fly   191 DCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFT 255
            .||:.|.|...|..|...|||.||:.||  .|..:||..:....|.:.|.|.:.|.|:||::.||
  Fly   304 ICGRGFVQNQQLVRHMNTHTGNRPYKCN--YCPAAFADRSTKTKHHRIHTKERPYVCDVCSRTFT 366

  Fly   256 QVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECD 305
            ...:|..|...|.|...:.|..| .|.|....:|..|.:||.....:..|
  Fly   367 YSDNLKFHKMIHTGEKPHVCDLC-GKGFVKAYKLRLHRETHNRRITWRND 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 54/202 (27%)
C2H2 Zn finger 133..153 CDD:275368 4/25 (16%)
zf-H2C2_2 145..170 CDD:290200 6/38 (16%)
C2H2 Zn finger 161..181 CDD:275368 5/19 (26%)
zf-H2C2_2 173..198 CDD:290200 8/24 (33%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368 6/20 (30%)
C2H2 Zn finger 304..324 CDD:275368 1/2 (50%)
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
tremNP_650861.1 zf-AD 11..87 CDD:214871 9/38 (24%)
COG5048 <264..411 CDD:227381 46/149 (31%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
zf-H2C2_2 287..311 CDD:290200 8/23 (35%)
C2H2 Zn finger 302..322 CDD:275368 7/19 (37%)
zf-H2C2_2 315..338 CDD:290200 10/24 (42%)
C2H2 Zn finger 330..350 CDD:275368 6/21 (29%)
zf-H2C2_2 345..367 CDD:290200 8/21 (38%)
C2H2 Zn finger 358..378 CDD:275368 7/19 (37%)
zf-H2C2_2 370..394 CDD:290200 7/24 (29%)
C2H2 Zn finger 386..406 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.