Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650860.1 | Gene: | CG4854 / 42391 | FlyBaseID: | FBgn0038766 | Length: | 319 | Species: | Drosophila melanogaster |
Alignment Length: | 321 | Identity: | 86/321 - (26%) |
---|---|---|---|
Similarity: | 125/321 - (38%) | Gaps: | 72/321 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 DTICRLCFQTATLFQVPGYSI-PTCVRCSEQLTNNSNFHQSAAAAAAVAASASA----AVAASAA 61
Fly 62 ----AAATSSSTASSSDSDAIAQQQQHQN-----PQQQQHQNSQQQQQQQQQMQSSSSS---ENL 114
Fly 115 QSQD----DSEDV-----DLI----------------------FNEEGS-------CPLCNKTFS 141
Fly 142 RKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHR 206
Fly 207 RLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAH 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 53/173 (31%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
CG4854 | NP_650860.1 | zf-AD | 12..>57 | CDD:285071 | 12/59 (20%) |
C2H2 Zn finger | 180..200 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 193..217 | CDD:290200 | 10/23 (43%) | ||
COG5048 | 201..>258 | CDD:227381 | 21/56 (38%) | ||
C2H2 Zn finger | 208..228 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 221..244 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 236..256 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 251..273 | CDD:290200 | 12/23 (52%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 277..301 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |