DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and CG8301

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649915.1 Gene:CG8301 / 41160 FlyBaseID:FBgn0037717 Length:607 Species:Drosophila melanogaster


Alignment Length:488 Identity:104/488 - (21%)
Similarity:171/488 - (35%) Gaps:155/488 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SAAAAATSSSTASSSDS---DAI----AQQQQHQNPQQQQHQNSQQQ------------------ 98
            :.:|....::|||....   ||:    |::::.:..||||:....::                  
  Fly   126 TVSAETQPNNTASDPIEIFVDAVDIDEAEEEEEEEEQQQQYDEEVEEPITDESAPPQLTISYACK 190

  Fly    99 ---------QQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGS---------------CPLCNKT 139
                     |.||..::..::|.:.:...:..:.:..|.:..|               |.:|.|.
  Fly   191 FCLRPQENYQLQQLLLEHINASHDPEQPYNCPECEARFQDAASRTVHLKSSHVEKQHACGVCGKK 255

  Fly   140 FSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVD------------- 191
            :..:.:|..|:..:.:|..|.|..|.|.|....:|..|.:.|..||.::|..             
  Fly   256 YGDRHNLRHHVEKYHSETDFECALCEKRFYTRKSLNYHMKWHNPDRQFKCRHSGCERLFISQRHL 320

  Fly   192 --------------------CGKTFTQITNLNNH-RRLHTGERPFVC-NEPE------------- 221
                                |||||..:..|..| .|.|.||:|:.| |..|             
  Fly   321 MCHEATHSGTSSRKSEHCGFCGKTFIHLKTLRWHIYRQHGGEKPYKCANCTEVFASYAEKRIHML 385

  Fly   222 -----------------CGRSFAQVTNLNNHMKSHH-------------------KVQQYC---- 246
                             |.:.|:...:|.:||.:.|                   :.:||.    
  Fly   386 ERHRENLTAIERSECMLCRQPFSSEPDLIHHMSAEHLQRPGAPIIANNKRVLQQKRERQYSGLFQ 450

  Fly   247 CNVCNKKFTQVTSLNQHLQAHAGV-TGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEK 310
            |..|:::|...::|.:|...|:.. ..:.||.| .|.||....:..|:|||....|..||.|.:.
  Fly   451 CGSCSQRFNMKSALERHAAVHSEKDRPHACPHC-SKRFKRAQDMKWHIKTHEKEKPNVCDVCGKA 514

  Fly   311 FLQQAHLDQHLKMHD--EFKFKCDICPSSFNQESLLKKHVQRHVEGRYLSCPVANCAESFAVRQH 373
            |..:..|.||...|:  |..|||::|..::..|..|:.|.:.|....|..|.:  |.|.|.....
  Fly   515 FALKYVLTQHRLSHEVLEKNFKCNVCGRAYLFEKSLRLHQRTHTGKTYYKCDL--CQERFVTHIK 577

  Fly   374 LSKHLLTNHAHHELPPPKRSKKAGTLQTSQQPL 406
            |..|:...||            |....::.|||
  Fly   578 LKTHMQKAHA------------ASQPHSADQPL 598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 82/359 (23%)
C2H2 Zn finger 133..153 CDD:275368 5/19 (26%)
zf-H2C2_2 145..170 CDD:290200 8/24 (33%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
zf-H2C2_2 173..198 CDD:290200 11/57 (19%)
C2H2 Zn finger 189..209 CDD:275368 9/53 (17%)
C2H2 Zn finger 217..239 CDD:275368 8/52 (15%)
zf-H2C2_2 231..256 CDD:290200 9/47 (19%)
C2H2 Zn finger 247..267 CDD:275368 5/19 (26%)
C2H2 Zn finger 275..296 CDD:275368 8/20 (40%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 331..351 CDD:275368 5/19 (26%)
C2H2 Zn finger 359..380 CDD:275368 6/20 (30%)
CG8301NP_649915.1 zf-AD 3..87 CDD:285071
COG5048 198..>508 CDD:227381 63/310 (20%)
C2H2 Zn finger 221..241 CDD:275368 2/19 (11%)
C2H2 Zn finger 249..269 CDD:275368 5/19 (26%)
C2H2 Zn finger 277..297 CDD:275368 6/19 (32%)
C2H2 Zn finger 305..327 CDD:275368 1/21 (5%)
C2H2 Zn finger 338..359 CDD:275368 8/20 (40%)
C2H2 Zn finger 367..384 CDD:275368 3/16 (19%)
C2H2 Zn finger 400..420 CDD:275368 5/19 (26%)
C2H2 Zn finger 451..471 CDD:275368 5/19 (26%)
C2H2 Zn finger 480..500 CDD:275368 8/20 (40%)
C2H2 Zn finger 508..528 CDD:275368 7/19 (37%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 565..582 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I1302
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.