DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Neu2

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_649316.1 Gene:Neu2 / 40375 FlyBaseID:FBgn0037085 Length:382 Species:Drosophila melanogaster


Alignment Length:322 Identity:88/322 - (27%)
Similarity:148/322 - (45%) Gaps:55/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 QQQHQ------NPQQQQHQN-----SQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEG--S 132
            ::.||      :.::::.:|     |::.:..::.:|..:...:..::.|..:.|:...|:.  |
  Fly    56 ERSHQFYRFLKDVREEESENDGSGCSEEVEAAERDLQDGADDVDSGNEPDINECDIKAKEKPGFS 120

  Fly   133 CPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFT 197
            |..|.|:|..||:|..|:|:|:.||.|.|:.|.|.|..::.|:||.|.||.:||:||..|.::||
  Fly   121 CSHCPKSFQVKSNLKVHMRSHTGERPFTCSLCPKSFGYSSGLQNHMRTHTGERPFQCSHCPRSFT 185

  Fly   198 QITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQ 262
            ...:|..|.::|.......|  |.|.:.|.....|..|:.:|....|:.|:.|:|.|.....|..
  Fly   186 AGHHLKAHIQMHERRGSLRC--PYCQKCFLTSLILKQHLATHTDETQFKCSQCSKSFQVEHELWM 248

  Fly   263 HLQAHAGVTGYYCPRCPEKNFKLQSQLHTHM---------------KTHGLAFPYECDKCDEKFL 312
            |::.|.... :.|..| .|:|.|.:.|..|:               ||.|.:...:|.||.:.|.
  Fly   249 HMRVHQERL-FTCGHC-SKDFALHAYLKRHLSRNARCSQSSKASAHKTLGHSKALKCGKCPKTFT 311

  Fly   313 QQAHLDQHLKMHDEFK-----------------------FKCDICPSSFNQESLLKKHVQRH 351
            .::.|..|||.|.:.|                       |||..||.:|:::|.|..|:|.|
  Fly   312 DRSALSTHLKSHTKNKPLLEGPCKSSGSKPAHSNAQRKPFKCSSCPRTFSRKSALLTHLQTH 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 82/268 (31%)
C2H2 Zn finger 133..153 CDD:275368 9/19 (47%)
zf-H2C2_2 145..170 CDD:290200 11/24 (46%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 12/24 (50%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 275..296 CDD:275368 8/35 (23%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
C2H2 Zn finger 331..351 CDD:275368 8/19 (42%)
C2H2 Zn finger 359..380 CDD:275368
Neu2NP_649316.1 zf-AD 1..63 CDD:285071 2/6 (33%)
COG5048 <119..241 CDD:227381 45/123 (37%)
C2H2 Zn finger 121..141 CDD:275368 9/19 (47%)
zf-H2C2_2 133..158 CDD:290200 11/24 (46%)
C2H2 Zn finger 149..169 CDD:275368 8/19 (42%)
zf-H2C2_2 162..185 CDD:290200 11/22 (50%)
C2H2 Zn finger 177..197 CDD:275368 6/19 (32%)
C2H2 Zn finger 205..225 CDD:275368 6/21 (29%)
zf-C2H2_8 206..286 CDD:292531 21/81 (26%)
C2H2 Zn finger 233..253 CDD:275368 6/19 (32%)
C2H2 Zn finger 260..297 CDD:275368 9/37 (24%)
C2H2 Zn finger 303..323 CDD:275368 8/19 (42%)
C2H2 Zn finger 353..373 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I1302
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.