DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZKSCAN4

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_061983.2 Gene:ZKSCAN4 / 387032 HGNCID:13854 Length:545 Species:Homo sapiens


Alignment Length:408 Identity:107/408 - (26%)
Similarity:163/408 - (39%) Gaps:71/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCFQTATLFQVPGYSIPTC----VRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSS 67
            ||.:.|.|.|..|.....|    .....:...:...|........:|........|..|:..|..
Human   152 LCCKMALLTQTQGSQSSQCQPMKALFKHESLGSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPG 216

  Fly    68 STASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGS 132
            |.......|....    ..|...|..:||....:.::.::.||..:|..:..::..||       
Human   217 SQGLLKMEDVALT----LTPGWTQLDSSQVNLYRDEKQENHSSLVSLGGEIQTKSRDL------- 270

  Fly   133 CPLCNKTFSRKSSLMTHIRNHSAE------------------------RKFVCTYCHKGFTQAAN 173
             |...|...::...:.|:|...|:                        |:..|..|.|.|.|::.
Human   271 -PPVKKLPEKEHGKICHLREDIAQIPTHAEAGEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSG 334

  Fly   174 LRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKS 238
            |..|.||||.::||:|.||||||...:.|..|:|:||||:|:.|.  |||:.|:..:||..|.::
Human   335 LTKHRRIHTGEKPYECEDCGKTFIGSSALVIHQRVHTGEKPYECE--ECGKVFSHSSNLIKHQRT 397

  Fly   239 HHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHG------ 297
            |...:.|.|:.|.|.|:|..||.:|.:.|.|...|.|..| .|.|:..|.|..|.:.||      
Human   398 HTGEKPYECDDCGKTFSQSCSLLEHHKIHTGEKPYQCNMC-GKAFRRNSHLLRHQRIHGDKNVQN 461

  Fly   298 ---------------------LAFPYECDKCDEKFLQQAHLDQHLKMH-DEFKFKCDICPSSFNQ 340
                                 ....|:|::|:..|.:...|.:|.|:| .|..::||.|...|.:
Human   462 PEHGESWESQGRTESQWENTEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTR 526

  Fly   341 ESLLKKHVQRHVEGRYLS 358
            .|.|.:|.:.||..:.||
Human   527 TSYLVQHQRSHVGKKTLS 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 86/287 (30%)
C2H2 Zn finger 133..153 CDD:275368 4/19 (21%)
zf-H2C2_2 145..170 CDD:290200 8/48 (17%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 15/24 (63%)
C2H2 Zn finger 189..209 CDD:275368 10/19 (53%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
C2H2 Zn finger 275..296 CDD:275368 7/20 (35%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..380 CDD:275368 107/408 (26%)
ZKSCAN4NP_061983.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..55
SCAN 49..160 CDD:128708 3/7 (43%)
KRAB 221..281 CDD:214630 12/71 (17%)
zf-C2H2 320..342 CDD:306579 8/21 (38%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
zf-H2C2_2 335..357 CDD:316026 13/21 (62%)
C2H2 Zn finger 350..370 CDD:275368 10/19 (53%)
COG5048 <374..544 CDD:227381 49/172 (28%)
C2H2 Zn finger 378..398 CDD:275368 8/21 (38%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
C2H2 Zn finger 434..454 CDD:275368 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..480 1/24 (4%)
C2H2 Zn finger 489..509 CDD:275368 6/19 (32%)
C2H2 Zn finger 517..537 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.