Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074686.1 | Gene: | Zfp174 / 385674 | MGIID: | 2686600 | Length: | 407 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 54/203 - (26%) |
---|---|---|---|
Similarity: | 96/203 - (47%) | Gaps: | 37/203 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 SDSDAIAQQQQHQNPQQQQHQNSQ-------------------------QQQQQQQQMQSSSSSE 112
Fly 113 NL-QSQDDSEDVDLIFNEEGSCPLCNKTFS---RKSSL------MTHIRNHSAERKFVCTYCHKG 167
Fly 168 FTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNL 232
Fly 233 NNHMKSHH 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 46/126 (37%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 7/28 (25%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 9/30 (30%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 5/10 (50%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | |||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Zfp174 | NP_001074686.1 | SCAN | 42..152 | CDD:128708 | |
SCAN | 42..130 | CDD:280241 | |||
C2H2 Zn finger | 328..348 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 340..365 | CDD:290200 | 12/24 (50%) | ||
COG5048 | 352..>407 | CDD:227381 | 25/56 (45%) | ||
C2H2 Zn finger | 356..376 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 369..393 | CDD:290200 | 12/25 (48%) | ||
C2H2 Zn finger | 384..404 | CDD:275368 | 8/21 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |