Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261387.1 | Gene: | CG12605 / 38468 | FlyBaseID: | FBgn0035481 | Length: | 619 | Species: | Drosophila melanogaster |
Alignment Length: | 319 | Identity: | 80/319 - (25%) |
---|---|---|---|
Similarity: | 128/319 - (40%) | Gaps: | 81/319 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 IPTCV-----RCSEQL-------TNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTAS--- 71
Fly 72 -----------SSDSDAIAQQQQHQNPQQQQHQNS----------------------QQQQQQQQ 103
Fly 104 QMQSSSSSENLQS-------QDDSEDVDLIFNEEGS-------------CPLCNKTFSRKSSLMT 148
Fly 149 HIRNH------SAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRR 207
Fly 208 LHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQA 266 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 49/162 (30%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 8/30 (27%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
CG12605 | NP_001261387.1 | zf-C2H2 | 439..461 | CDD:278523 | 6/21 (29%) |
C2H2 Zn finger | 441..461 | CDD:275370 | 6/19 (32%) | ||
C2H2 Zn finger | 472..492 | CDD:275368 | 5/21 (24%) | ||
COG5048 | 492..>570 | CDD:227381 | 30/79 (38%) | ||
zf-C2H2 | 496..518 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 498..518 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 511..534 | CDD:290200 | 11/24 (46%) | ||
zf-C2H2 | 524..546 | CDD:278523 | 9/23 (39%) | ||
C2H2 Zn finger | 526..546 | CDD:275368 | 9/21 (43%) | ||
zf-H2C2_2 | 538..562 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 554..571 | CDD:275368 | 7/16 (44%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |