DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zscan30

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006254540.1 Gene:Zscan30 / 364827 RGDID:1306095 Length:534 Species:Rattus norvegicus


Alignment Length:389 Identity:109/389 - (28%)
Similarity:168/389 - (43%) Gaps:48/389 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LCFQTATLFQVPGYSIPTCV---RCSEQLTNNSNFHQ----------------SAAAAAAVAASA 52
            :|.:|..:......|.|...   .|..:|.....||:                .|...|..|...
  Rat   145 ICKETTLMGMSESLSSPLQSLENHCKSELQEPQVFHERDKATLPFRVEDEDSKMATGKALTAKQE 209

  Fly    53 SAAVAASAAAAATSSSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSS------ 111
            .....||.|..:.......:|....:.:..:..:.::||..:....:......|....|      
  Rat   210 GIECVASVAMESPGRLPRETSPVQRVEETMEFLDNEKQQGSDDTSNKTSPLSSQEGGFSLAPFSK 274

  Fly   112 -----ENLQSQDDSEDVDLIFNEEG-------------SCPLCNKTFSRKSSLMTHIRNHSAERK 158
                 :|:...::||.: |..|..|             :|..|.|.|..:|.|:.|.|:|:.||.
  Rat   275 KTPTEQNIFEYNESEGI-LSQNLHGTTQPRTDTGKLLYACMDCGKAFCNRSKLIRHQRSHTGERP 338

  Fly   159 FVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECG 223
            :.|..|.|.|...|:|..|:|||:.::||:|.||||.|...|.|..|||:||||:|:.|:  |||
  Rat   339 YACKECGKAFGFRADLVRHQRIHSGEKPYKCCDCGKAFGNNTGLTRHRRIHTGEKPYGCD--ECG 401

  Fly   224 RSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQ 288
            |:|:|.:.|..|.|.|...:.|.|..|.:.|.|.::|.||.:.|:|..|:.|..| .|.|.....
  Rat   402 RAFSQCSTLIQHKKIHSGEKPYSCEECGRAFVQSSALIQHKKIHSGDKGFKCTEC-GKTFWTSYV 465

  Fly   289 LHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMHD-EFKFKCDICPSSFNQESLLKKHVQRH 351
            |..|.:.|....||:|::|.:.|.:...|..|.:.|. |..::|:.|..:|...|.|.:|.:.|
  Rat   466 LREHQRIHTGEKPYQCNECGKSFNRSTALTVHQRTHSGEKPYECNECRKTFRHRSGLVRHQRTH 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 87/242 (36%)
C2H2 Zn finger 133..153 CDD:275368 8/19 (42%)
zf-H2C2_2 145..170 CDD:290200 10/24 (42%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 13/24 (54%)
C2H2 Zn finger 189..209 CDD:275368 11/19 (58%)
C2H2 Zn finger 217..239 CDD:275368 10/21 (48%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368 6/20 (30%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..380 CDD:275368
Zscan30XP_006254540.1 SCAN 44..153 CDD:413396 2/7 (29%)
COG5048 293..>374 CDD:227381 28/80 (35%)
C2H2 Zn finger 313..333 CDD:275368 8/19 (42%)
COG5048 <338..525 CDD:227381 71/189 (38%)
C2H2 Zn finger 341..361 CDD:275368 8/19 (42%)
C2H2 Zn finger 369..389 CDD:275368 11/19 (58%)
C2H2 Zn finger 397..417 CDD:275368 10/21 (48%)
C2H2 Zn finger 425..445 CDD:275368 7/19 (37%)
C2H2 Zn finger 453..473 CDD:275368 6/20 (30%)
C2H2 Zn finger 481..501 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.