DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32772 and Zfp24

DIOPT Version :9

Sequence 1:	NP_001284870.1	Gene:	CG32772 / 31420	FlyBaseID:	FBgn0052772	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_892000.1	Gene:	Zfp24 / 360204	RGDID:	727963	Length:	368	Species:	Rattus norvegicus

Alignment Length:	108	Identity:	47/108 - (43%)
Similarity:	76/108 - (70%)	Gaps:	2/108 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   133 CPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFT 197
            |..|.|.||:.|:|:.|.|.||.|:.:.|..|.|.|::::.|..|:|:||.::||:|::|||.|:
  Rat   253 CDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFS 317

  Fly   198 QITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHH 240
            |.:.|.||:|:||||:|:.|  .:||:|::|.:||..|.:.|:
  Rat   318 QNSGLINHQRIHTGEKPYEC--VQCGKSYSQSSNLFRHQRRHN 358

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32772	NP_001284870.1	COG5048	<124..378	CDD:227381	47/108 (44%)
		C2H2 Zn finger	133..153	CDD:275368	9/19 (47%)
		zf-H2C2_2	145..170	CDD:290200	10/24 (42%)
		C2H2 Zn finger	161..181	CDD:275368	7/19 (37%)
		zf-H2C2_2	173..198	CDD:290200	12/24 (50%)
		C2H2 Zn finger	189..209	CDD:275368	10/19 (53%)
		C2H2 Zn finger	217..239	CDD:275368	8/21 (38%)
		zf-H2C2_2	231..256	CDD:290200	4/10 (40%)
		C2H2 Zn finger	247..267	CDD:275368
		C2H2 Zn finger	275..296	CDD:275368
		C2H2 Zn finger	304..324	CDD:275368
		C2H2 Zn finger	331..351	CDD:275368
		C2H2 Zn finger	359..380	CDD:275368
Zfp24	NP_892000.1	SCAN	48..159	CDD:128708
		SCAN	48..136	CDD:280241
		CdhC	<101..173	CDD:299819
		COG5048	<249..329	CDD:227381	33/75 (44%)
		Necessary and sufficient for nuclear localization. /evidence=ECO:0000250	251..301		19/47 (40%)
		zf-C2H2	251..273	CDD:278523	9/19 (47%)
		C2H2 Zn finger	253..273	CDD:275368	9/19 (47%)
		zf-H2C2_2	269..290	CDD:290200	9/20 (45%)
		C2H2 Zn finger	281..301	CDD:275368	7/19 (37%)
		zf-H2C2_2	294..318	CDD:290200	12/23 (52%)
		COG5048	305..>358	CDD:227381	25/54 (46%)
		C2H2 Zn finger	309..329	CDD:275368	10/19 (53%)
		zf-H2C2_2	322..346	CDD:290200	13/25 (52%)
		C2H2 Zn finger	337..357	CDD:275368	8/21 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100