DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZBTB41

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_919290.2 Gene:ZBTB41 / 360023 HGNCID:24819 Length:909 Species:Homo sapiens


Alignment Length:588 Identity:120/588 - (20%)
Similarity:203/588 - (34%) Gaps:204/588 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 TSSSTASSSD-SDAIAQQQQHQNPQQQQHQNSQ--------QQQQQQQQMQSSSSSENLQSQDDS 120
            ||.....|.| ||.:  .|::.:.::....:|:        ::.:.:::|....|....||:.|.
Human   266 TSDDEQESGDGSDNL--NQENFDKEKSDRNDSEDPGSEYNAEEDELEEEMSDEYSDIEEQSEKDH 328

  Fly   121 EDV-------DLIFN-EEG--------------SCPLCNKTFSRKSSLMTHIRNHSAERKFVCTY 163
            .|.       |.:.| .||              .||.|:|||.|.....:|.|.|:.|:.|.|..
Human   329 NDAEEEPEAGDSVGNVHEGLTPVVIQNSNKKILQCPKCDKTFDRIGKYESHTRVHTGEKPFECDI 393

  Fly   164 CHKGFTQAANLRNHERIHTNDR---------PY-------------------------------- 187
            ||:.::..:||..|.:.|:|:.         ||                                
Human   394 CHQRYSTKSNLTVHRKKHSNETEFHKKEHKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIKKT 458

  Fly   188 -----QCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPE-------------------------C 222
                 :|..|.|:||:..:|..|..||:.::||.|...|                         |
Human   459 KSESWKCDICKKSFTRRPHLEEHMILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDIC 523

  Fly   223 GRSFAQVTNLNNHMK-SHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQ 286
            ||.|....||..|:: :|...:::.|.:|.|...:.|:|.:||:.|:|...:.|..|.: :|:..
Human   524 GRQFNDTGNLKRHIECTHGGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQ-SFRHG 587

  Fly   287 SQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMHDEFK----------------------- 328
            |....|::.|.....||||:|.:.|::..||.:|.|:|...|                       
Human   588 SSYRLHLRVHHDDKRYECDECGKTFIRHDHLTKHKKIHSGEKAHQCEECGKCFGRRDHLTVHYKS 652

  Fly   329 ---------------FKCDICPSSFNQESLLKKHVQRHVEGRYLSCPVANCAESFAVRQHLSKHL 378
                           .:||:|...|..:|.|:.|.:.|...:...|.:  |.:||.:::.|:|||
Human   653 VHLGEKVWQKYKATFHQCDVCKKIFKGKSSLEMHFRTHSGEKPYKCQI--CNQSFRIKKTLTKHL 715

  Fly   379 LTNHAHHELPPPKRSKKAGTLQTSQQPLAMIGQPLSLQHTTGQRGRPPKNKNKATTLAATAIKIE 443
            :   .|.:                       .:|.:.||......|..|.|              
Human   716 V---IHSD-----------------------ARPFNCQHCNATFKRKDKLK-------------- 740

  Fly   444 INESLHSQHISNVS--------------GLSIQQQINQHMQQQAAQQQAQQQAAQQQQQQAAQQQ 494
                .|..|:..:.              .|.::...:..:.|...:|...|....|.:.:...|.
Human   741 ----YHIDHVHEIKSPDDPLSTSEEKLVSLPVEYSSDDKIFQTETKQYMDQPKVYQSEAKTMLQN 801

  Fly   495 QQA 497
            ..|
Human   802 VSA 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 88/378 (23%)
C2H2 Zn finger 133..153 CDD:275368 9/19 (47%)
zf-H2C2_2 145..170 CDD:290200 8/24 (33%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
zf-H2C2_2 173..198 CDD:290200 11/70 (16%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..239 CDD:275368 9/47 (19%)
zf-H2C2_2 231..256 CDD:290200 7/25 (28%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368 5/20 (25%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..380 CDD:275368 8/20 (40%)
ZBTB41NP_919290.2 BTB_POZ_ZBTB41 66..179 CDD:349535
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..344 15/79 (19%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
C2H2 Zn finger 424..442 CDD:275368 2/17 (12%)
C2H2 Zn finger 465..485 CDD:275368 7/19 (37%)
C2H2 Zn finger 493..510 CDD:275368 2/16 (13%)
C2H2 Zn finger 520..541 CDD:275368 7/20 (35%)
C2H2 Zn finger 549..569 CDD:275368 7/19 (37%)
C2H2 Zn finger 577..597 CDD:275368 5/20 (25%)
zf-C2H2 603..625 CDD:395048 10/21 (48%)
C2H2 Zn finger 605..625 CDD:275368 8/19 (42%)
C2H2 Zn finger 633..651 CDD:275368 0/17 (0%)
C2H2 Zn finger 670..687 CDD:275368 6/16 (38%)
C2H2 Zn finger 698..718 CDD:275368 8/24 (33%)
C2H2 Zn finger 726..743 CDD:275368 5/34 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.