Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001012999.3 | Gene: | ZKSCAN2 / 342357 | HGNCID: | 25677 | Length: | 967 | Species: | Homo sapiens |
Alignment Length: | 314 | Identity: | 84/314 - (26%) |
---|---|---|---|
Similarity: | 144/314 - (45%) | Gaps: | 56/314 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 AATSSSTASSSDSDAIAQQQQHQNP--------------------------QQQQH--------- 92
Fly 93 ---QNSQQQQQQQQQMQSSSSSENL----QSQDDSEDVDL---IFNEE---GSCPL----CNKTF 140
Fly 141 SRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNH 205
Fly 206 RRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGV 270
Fly 271 TGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 69/211 (33%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 5/23 (22%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
ZKSCAN2 | NP_001012999.3 | SCAN | 41..148 | CDD:128708 | |
SCAN | 41..129 | CDD:280241 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 150..205 | ||||
KRAB_A-box | 227..268 | CDD:143639 | |||
KRAB | <248..289 | CDD:214630 | |||
Myb_DNA-bind_4 | 340..421 | CDD:290549 | |||
Myb_DNA-bind_4 | 497..578 | CDD:290549 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 586..626 | ||||
COG5048 | 771..>957 | CDD:227381 | 60/171 (35%) | ||
zf-C2H2 | 775..797 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 777..797 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 789..813 | CDD:290200 | 12/23 (52%) | ||
zf-C2H2 | 803..825 | CDD:278523 | 9/21 (43%) | ||
C2H2 Zn finger | 805..825 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2 | 831..853 | CDD:278523 | 8/23 (35%) | ||
C2H2 Zn finger | 833..853 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 845..870 | CDD:290200 | 8/24 (33%) | ||
C2H2 Zn finger | 861..881 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 873..898 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 889..909 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 902..925 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 917..937 | CDD:275368 | 5/19 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 941..967 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |