| Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_956119.2 | Gene: | zgc:66483 / 327554 | ZFINID: | ZDB-GENE-030131-5765 | Length: | 231 | Species: | Danio rerio |
| Alignment Length: | 237 | Identity: | 75/237 - (31%) |
|---|---|---|---|
| Similarity: | 107/237 - (45%) | Gaps: | 22/237 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 88 QQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHIRN 152
Fly 153 HSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVC 217
Fly 218 NEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKN 282
Fly 283 FKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH 324 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 69/201 (34%) |
| C2H2 Zn finger | 133..153 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 145..170 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 161..181 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 173..198 | CDD:290200 | 13/24 (54%) | ||
| C2H2 Zn finger | 189..209 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 217..239 | CDD:275368 | 5/21 (24%) | ||
| zf-H2C2_2 | 231..256 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 247..267 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 275..296 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 304..324 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 331..351 | CDD:275368 | |||
| C2H2 Zn finger | 359..380 | CDD:275368 | |||
| zgc:66483 | NP_956119.2 | COG5048 | <15..221 | CDD:227381 | 72/226 (32%) |
| C2H2 Zn finger | 42..62 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 70..90 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 83..107 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 98..118 | CDD:275368 | 10/19 (53%) | ||
| C2H2 Zn finger | 126..146 | CDD:275368 | 5/21 (24%) | ||
| C2H2 Zn finger | 154..174 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 167..191 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 182..202 | CDD:275368 | 7/20 (35%) | ||
| zf-H2C2_2 | 194..219 | CDD:290200 | 8/24 (33%) | ||
| C2H2 Zn finger | 210..230 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR23226 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||