DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and CG2202

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_572657.2 Gene:CG2202 / 32014 FlyBaseID:FBgn0030240 Length:889 Species:Drosophila melanogaster


Alignment Length:347 Identity:106/347 - (30%)
Similarity:142/347 - (40%) Gaps:67/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SENLQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTH-IRNHSAE------------RKFVCT 162
            |::|::...|    |..|:|..|.||...|||..:|..| :..|:.|            .:..|.
  Fly   514 SDHLKAHVQS----LHSNKEHKCSLCEAAFSRLDALERHKVSKHNGEGLEPGSELKLQLAEHTCE 574

  Fly   163 YCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFA 227
            ||.|.|:....||.|..:|| |..|.|..|.:||.:...|..|.:.|||:|.|:|  ..||.|||
  Fly   575 YCSKRFSSKTYLRKHTLLHT-DFLYACKTCDETFRERAQLREHEKTHTGQRNFLC--CICGDSFA 636

  Fly   228 QVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTH 292
            :...|..||:.|:..:.|.|..|.|.|.:.|.|..|.:.|.|.....|..| .|:|.....|..|
  Fly   637 RNDYLRVHMRRHNGEKPYKCRFCVKAFPRATDLKVHERYHTGTKPNLCNTC-GKSFHRAYNLTIH 700

  Fly   293 MKTHGLAFPYECDKCDEKFLQQAHLDQHLKMHDEFKFKCDICPSSFNQESLLKKHVQRHVEGRYL 357
            |:||....||                           |||.||.||.|.:.||.|::||...|| 
  Fly   701 MRTHTGERPY---------------------------KCDQCPKSFTQSNDLKAHIRRHTGERY- 737

  Fly   358 SCPVANCAESFAVRQHLSKHLLTNHAHHELPPPKRSKKAGTLQTSQQPLAMIGQPLSLQHTTGQR 422
            .||  :|...|....::..|.::.|..|......|.::.|.|....|           .|.|...
  Fly   738 KCP--HCDAYFLQLYNMRNHCMSAHNKHIETKTGRLQRTGLLDDGGQ-----------SHLTTVV 789

  Fly   423 GRPPKNKNK-----ATTLAATA 439
            ..|.:..|:     |.|.||||
  Fly   790 MPPARYPNELDPQLAATAAATA 811

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 86/266 (32%)
C2H2 Zn finger 133..153 CDD:275368 8/20 (40%)
zf-H2C2_2 145..170 CDD:290200 9/37 (24%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 11/24 (46%)
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
C2H2 Zn finger 217..239 CDD:275368 9/21 (43%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368 7/20 (35%)
C2H2 Zn finger 304..324 CDD:275368 0/19 (0%)
C2H2 Zn finger 331..351 CDD:275368 10/19 (53%)
C2H2 Zn finger 359..380 CDD:275368 5/20 (25%)
CG2202NP_572657.2 zf-AD 45..121 CDD:285071
C2H2 Zn finger 150..171 CDD:275368
C2H2 Zn finger 192..213 CDD:275370
C2H2 Zn finger 221..239 CDD:275370
COG5048 <443..730 CDD:227381 81/250 (32%)
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..513 CDD:290200
C2H2 Zn finger 504..525 CDD:275368 3/14 (21%)
C2H2 Zn finger 532..548 CDD:275368 7/15 (47%)
C2H2 Zn finger 573..593 CDD:275368 8/19 (42%)
C2H2 Zn finger 600..620 CDD:275368 6/19 (32%)
zf-H2C2_2 613..637 CDD:290200 12/25 (48%)
C2H2 Zn finger 628..648 CDD:275368 9/21 (43%)
zf-H2C2_2 640..663 CDD:290200 8/22 (36%)
C2H2 Zn finger 656..676 CDD:275368 7/19 (37%)
C2H2 Zn finger 684..704 CDD:275368 7/20 (35%)
zf-C2H2 684..704 CDD:278523 7/20 (35%)
zf-H2C2_2 696..721 CDD:290200 14/51 (27%)
C2H2 Zn finger 712..732 CDD:275368 10/19 (53%)
C2H2 Zn finger 739..755 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 121 1.000 Inparanoid score I1302
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.