DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zfp110

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006228173.1 Gene:Zfp110 / 308362 RGDID:1306339 Length:865 Species:Rattus norvegicus


Alignment Length:389 Identity:101/389 - (25%)
Similarity:153/389 - (39%) Gaps:113/389 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GYSIPTCVRCSEQ-----------LTNNSNFHQSAAAAA---------AVAASASAAVAASAA-- 61
            ||||.. .|.|||           ||.::.|:|.|..:.         |:.......:...:.  
  Rat   508 GYSIKN-QRGSEQGTAGARRDPITLTVSAQFYQKATGSEEGRFRDNSNAIVPDTPTKIHQKSPEW 571

  Fly    62 -AAATSSSTASSSDSDAIA--------------------QQQQHQNPQQQQHQNSQQQQQQQQQM 105
             ....|:::.||..:|.:.                    .|:.::..:.|.::||.:..:..|: 
  Rat   572 HKVGRSNNSMSSVQNDQMGSGAGRGRDNTILTHALPVKIHQKGYEEGKVQGNRNSLRHVKAHQK- 635

  Fly   106 QSSSSSENLQSQDDSE-DVDLIFN-------EEG--------------SC------------PLC 136
              .|..|.::....|| .|..|.|       |:|              :|            ..|
  Rat   636 --GSKGERVRELSTSEKHVPYIKNHLKTSEREKGRENNDSIKYGPYIKTCYRGSEVRKLRRANNC 698

  Fly   137 NKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITN 201
            .|..||.:..:..|:.|...:...|:.|.|.|..:.....|::|||.:|||.|:.|||.|.|.::
  Rat   699 TKAISRHAQQIFFIKIHKGSQVCRCSECGKMFRNSRYFSVHKKIHTGERPYMCMACGKAFVQSSS 763

  Fly   202 LNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQA 266
            |..|.|:|:|||||.|:  ||||:|                        |.:    ::::|||:.
  Rat   764 LTQHLRIHSGERPFECS--ECGRTF------------------------NDR----SAISQHLRT 798

  Fly   267 HAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMHDEFKFK 330
            |.|...|:|..| .|.|:..|.|..|.:||....||.|..|.:.|.|.:||..|.|.| ..|||
  Rat   799 HTGAKPYHCQHC-GKAFRQSSHLTRHERTHTGERPYVCSNCGKAFTQSSHLIGHQKTH-RIKFK 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 73/240 (30%)
C2H2 Zn finger 133..153 CDD:275368 6/31 (19%)
zf-H2C2_2 145..170 CDD:290200 6/24 (25%)
C2H2 Zn finger 161..181 CDD:275368 5/19 (26%)
zf-H2C2_2 173..198 CDD:290200 12/24 (50%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 1/24 (4%)
C2H2 Zn finger 247..267 CDD:275368 4/19 (21%)
C2H2 Zn finger 275..296 CDD:275368 7/20 (35%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
C2H2 Zn finger 331..351 CDD:275368 101/389 (26%)
C2H2 Zn finger 359..380 CDD:275368
Zfp110XP_006228173.1 KRAB 57..116 CDD:214630
KRAB 57..96 CDD:279668
SCAN 200..328 CDD:128708
SCAN 200..283 CDD:280241
KRAB 321..>361 CDD:214630
KRAB 321..360 CDD:279668
C2H2 Zn finger 696..715 CDD:275370 5/18 (28%)
C2H2 Zn finger 723..743 CDD:275368 5/19 (26%)
zf-H2C2_2 735..760 CDD:290200 12/24 (50%)
COG5048 747..>804 CDD:227381 30/86 (35%)
C2H2 Zn finger 751..771 CDD:275368 9/19 (47%)
zf-H2C2_2 763..787 CDD:290200 15/49 (31%)
zf-C2H2 777..799 CDD:278523 11/51 (22%)
C2H2 Zn finger 779..799 CDD:275368 10/49 (20%)
zf-C2H2 805..827 CDD:278523 8/22 (36%)
C2H2 Zn finger 807..827 CDD:275368 7/20 (35%)
zf-H2C2_2 819..844 CDD:290200 9/24 (38%)
C2H2 Zn finger 835..855 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.