Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_218239.6 | Gene: | Zscan5b / 292566 | RGDID: | 1559143 | Length: | 484 | Species: | Rattus norvegicus |
Alignment Length: | 247 | Identity: | 72/247 - (29%) |
---|---|---|---|
Similarity: | 106/247 - (42%) | Gaps: | 41/247 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 SIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTASSSDSDAIAQQQQHQ 85
Fly 86 NPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHI 150
Fly 151 RNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPF 215
Fly 216 VCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAH 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 56/144 (39%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 13/24 (54%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Zscan5b | XP_218239.6 | SCAN | 33..112 | CDD:153421 | |
COG5048 | <261..>432 | CDD:227381 | 60/211 (28%) | ||
C2H2 Zn finger | 334..354 | CDD:275368 | 9/19 (47%) | ||
SFP1 | <356..411 | CDD:227516 | 24/54 (44%) | ||
C2H2 Zn finger | 362..382 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 374..399 | CDD:404364 | 13/24 (54%) | ||
C2H2 Zn finger | 390..410 | CDD:275368 | 8/19 (42%) | ||
zf-C2H2 | 416..438 | CDD:395048 | 8/23 (35%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/21 (33%) | ||
zf-C2H2 | 444..466 | CDD:395048 | 8/21 (38%) | ||
C2H2 Zn finger | 446..466 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |