DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zfp213

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006245924.1 Gene:Zfp213 / 287094 RGDID:1305919 Length:468 Species:Rattus norvegicus


Alignment Length:145 Identity:53/145 - (36%)
Similarity:82/145 - (56%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 DLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQ 188
            :|:..:..||..|.|.|...|.|..|.|.|:.|:...|..|.|.|..:::|..|:.:||.::|:.
  Rat   319 NLVTEKPHSCAQCGKRFRWGSDLARHQRTHTGEKPHKCPECDKSFRSSSDLVRHQGVHTGEKPFS 383

  Fly   189 CVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKK 253
            |.:|||:|::...|.:|:|:||||:||.|.  |||:||:..:.|.:|.:.|...:.:.|..|:|.
  Rat   384 CSECGKSFSRSAYLADHQRIHTGEKPFSCT--ECGKSFSLRSYLLDHRRVHTGERPFGCGECDKS 446

  Fly   254 FTQVTSLNQHLQAHA 268
            |.|...|..|...||
  Rat   447 FKQRAHLIAHQSLHA 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 53/145 (37%)
C2H2 Zn finger 133..153 CDD:275368 8/19 (42%)
zf-H2C2_2 145..170 CDD:290200 9/24 (38%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
zf-H2C2_2 173..198 CDD:290200 10/24 (42%)
C2H2 Zn finger 189..209 CDD:275368 8/19 (42%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 7/24 (29%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
Zfp213XP_006245924.1 SCAN 41..140 CDD:128708
SCAN 41..124 CDD:280241
KRAB_A-box 213..247 CDD:143639
COG5048 <324..460 CDD:227381 50/137 (36%)
C2H2 Zn finger 328..348 CDD:275368 8/19 (42%)
zf-H2C2_2 340..365 CDD:290200 9/24 (38%)
C2H2 Zn finger 356..376 CDD:275368 6/19 (32%)
zf-H2C2_2 368..393 CDD:290200 10/24 (42%)
C2H2 Zn finger 384..404 CDD:275368 8/19 (42%)
zf-H2C2_2 396..420 CDD:290200 14/25 (56%)
zf-C2H2 410..432 CDD:278523 9/23 (39%)
C2H2 Zn finger 412..432 CDD:275368 8/21 (38%)
zf-H2C2_2 424..449 CDD:290200 7/24 (29%)
C2H2 Zn finger 440..460 CDD:275368 7/19 (37%)
zf-C2H2 440..460 CDD:278523 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.