DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZNF500

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_067678.1 Gene:ZNF500 / 26048 HGNCID:23716 Length:480 Species:Homo sapiens


Alignment Length:145 Identity:56/145 - (38%)
Similarity:90/145 - (62%) Gaps:3/145 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 NHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFV 216
            :|.|::.:.|..|.|||::.::|..|:|.||.:|||:|:.|||.|:..:|.:.|:|:||||:|:.
Human   318 SHGADKPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLVCGKGFSDRSNFSTHQRVHTGEKPYP 382

  Fly   217 CNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEK 281
            |  ||||:.|:|.::|..|.::|...:.|.|..|.|:|...:..:.|.:.|.|...|.||.| .:
Human   383 C--PECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNNSSHFSAHRRTHTGEKPYTCPAC-GR 444

  Fly   282 NFKLQSQLHTHMKTH 296
            .|:..:.||.|.:||
Human   445 GFRRGTDLHKHQRTH 459

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 56/145 (39%)