DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG32772 and ZNF396

DIOPT Version :9

Sequence 1:	NP_001284870.1	Gene:	CG32772 / 31420	FlyBaseID:	FBgn0052772	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_001309215.1	Gene:	ZNF396 / 252884	HGNCID:	18824	Length:	335	Species:	Homo sapiens

Alignment Length:	126	Identity:	42/126 - (33%)
Similarity:	62/126 - (49%)	Gaps:	7/126 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    84 HQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMT 148
            |.|.....|.|..|....:...:.....|..|....       :.::..|..|.|.||:.|:|:.
Human   211 HCNVSNILHMNGSQSSTYRGTYEQDGRFEKRQGNPS-------WKKQQKCDECGKIFSQSSALIL 268

  Fly   149 HIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLH 209
            |.|.||.::.:.|..|.|.|:::|.|..|.|.||.::||:|.||||.|:|.:||..||:.|
Human   269 HQRIHSGKKPYACDECAKAFSRSAILIQHRRTHTGEKPYKCHDCGKAFSQSSNLFRHRKRH 329

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG32772	NP_001284870.1	COG5048	<124..378	CDD:227381	35/86 (41%)
		C2H2 Zn finger	133..153	CDD:275368	9/19 (47%)
		zf-H2C2_2	145..170	CDD:290200	9/24 (38%)
		C2H2 Zn finger	161..181	CDD:275368	8/19 (42%)
		zf-H2C2_2	173..198	CDD:290200	13/24 (54%)
		C2H2 Zn finger	189..209	CDD:275368	11/19 (58%)
		C2H2 Zn finger	217..239	CDD:275368
		zf-H2C2_2	231..256	CDD:290200
		C2H2 Zn finger	247..267	CDD:275368
		C2H2 Zn finger	275..296	CDD:275368
		C2H2 Zn finger	304..324	CDD:275368
		C2H2 Zn finger	331..351	CDD:275368
		C2H2 Zn finger	359..380	CDD:275368
ZNF396	NP_001309215.1	SCAN	48..157	CDD:128708
		SCAN	48..136	CDD:280241
		COG5048	239..>306	CDD:227381	23/73 (32%)
		zf-C2H2	252..273	CDD:278523	9/20 (45%)
		C2H2 Zn finger	253..273	CDD:275368	9/19 (47%)
		zf-H2C2_2	269..290	CDD:290200	8/20 (40%)
		C2H2 Zn finger	281..301	CDD:275368	8/19 (42%)
		zf-H2C2_2	294..318	CDD:290200	13/23 (57%)
		C2H2 Zn finger	309..329	CDD:275368	11/19 (58%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR23226
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.100