Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011248809.1 | Gene: | Zscan18 / 232875 | MGIID: | 3643810 | Length: | 864 | Species: | Mus musculus |
Alignment Length: | 209 | Identity: | 44/209 - (21%) |
---|---|---|---|
Similarity: | 77/209 - (36%) | Gaps: | 34/209 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 VPGYSIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTASSSDSD---AI 78
Fly 79 AQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSR- 142
Fly 143 ----KSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTND-RPYQCVDCGKTFTQITNL 202
Fly 203 NNHRRLHTGERPFV 216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 20/99 (20%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 4/24 (17%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 2/24 (8%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 6/25 (24%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 8/19 (42%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 44/209 (21%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | |||
C2H2 Zn finger | 247..267 | CDD:275368 | |||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Zscan18 | XP_011248809.1 | PAT1 | <55..>208 | CDD:370676 | |
SCAN | 453..540 | CDD:366881 | |||
C2H2 Zn finger | 833..853 | CDD:275370 | 8/19 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |