DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zscan18

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011248809.1 Gene:Zscan18 / 232875 MGIID:3643810 Length:864 Species:Mus musculus


Alignment Length:209 Identity:44/209 - (21%)
Similarity:77/209 - (36%) Gaps:34/209 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VPGYSIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTASSSDSD---AI 78
            :||.|:|...|   |..:..|..:..:....:..|.|..|..||     |..||...:..   |:
Mouse   677 LPGGSLPDSTR---QQESKGNVCEEVSLGETLMESLSGDVPVSA-----SIDTALEEEQQPQKAL 733

  Fly    79 AQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKTFSR- 142
            ..:.:..:|...|.|:..||..|.:......:.......||.:::         .|.|..:.|. 
Mouse   734 DAEGEDSSPASPQRQSVIQQSAQDKDRPHQGTGTKRPHPDDEDEM---------APECLSSTSSY 789

  Fly   143 ----KSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTND-RPYQCVDCGKTFTQITNL 202
                .:..:.|:..|.:.:        ...|.|....:.::...:. :||.|.:||:.|..|:||
Mouse   790 QLPFDAGKVLHVDGHDSGQ--------DSGTSAGGCSSADKSDASQGKPYTCSECGEAFAWISNL 846

  Fly   203 NNHRRLHTGERPFV 216
            ..|.:.|..|..:|
Mouse   847 MEHHKSHGSETCYV 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 20/99 (20%)
C2H2 Zn finger 133..153 CDD:275368 4/24 (17%)
zf-H2C2_2 145..170 CDD:290200 2/24 (8%)
C2H2 Zn finger 161..181 CDD:275368 2/19 (11%)
zf-H2C2_2 173..198 CDD:290200 6/25 (24%)
C2H2 Zn finger 189..209 CDD:275368 8/19 (42%)
C2H2 Zn finger 217..239 CDD:275368 44/209 (21%)
zf-H2C2_2 231..256 CDD:290200
C2H2 Zn finger 247..267 CDD:275368
C2H2 Zn finger 275..296 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
Zscan18XP_011248809.1 PAT1 <55..>208 CDD:370676
SCAN 453..540 CDD:366881
C2H2 Zn finger 833..853 CDD:275370 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.