DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zscan21

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001038168.1 Gene:Zscan21 / 22697 MGIID:99182 Length:555 Species:Mus musculus


Alignment Length:353 Identity:91/353 - (25%)
Similarity:154/353 - (43%) Gaps:70/353 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AAAATSSSTASSSDSDAIAQQQQH------------------QNPQQQQHQNSQQQQQQQQQMQS 107
            :.:.|:..:.||:::..:....::                  |:|:::|...|..|::.......
Mouse   226 STSGTAMESLSSTETQHVDASPKYEFWGPLYIQETGEEEVFTQDPRKRQGFKSNPQKEDSADEHR 290

  Fly   108 SSSSEN-----------------LQSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSA 155
            ||..|:                 ..|:.:.:..:.:..|.|:......|.|||.:.....|....
Mouse   291 SSEEESHADGLKRTVIPMIPANKYGSRSERQWANNLERERGTKASLQDTGSRKGAEPASTRPAPG 355

  Fly   156 ERKFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEP 220
            |::::|..|.|.|:.::||..|.|.||.::||.|..|||.|:..:||..|.|.|..:||:.|   
Mouse   356 EKRYICAECGKAFSNSSNLTKHRRTHTGEKPYVCTKCGKAFSHSSNLTLHYRTHLVDRPYDC--- 417

  Fly   221 ECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKL 285
            :||::|.|.::|..|.:.|.:...|.|..|.|.|:...||.:|.:.|.|          ||    
Mouse   418 KCGKAFGQSSDLLKHQRMHTEEAPYQCKDCGKAFSGKGSLIRHYRIHTG----------EK---- 468

  Fly   286 QSQLHTHMKTHGLAFPYECDKCDEKFLQQAHLDQHLKMH-DEFKFKCDICPSSFNQESLLKKHVQ 349
                           ||:|::|.:.|.|.|.|..|.::| .|..:||..|..:||..|...||.:
Mouse   469 ---------------PYQCNECGKSFSQHAGLSSHQRLHTGEKPYKCKECGKAFNHSSNFNKHHR 518

  Fly   350 RHVEGRYLSCPVANCAESFAVRQHLSKH 377
            .|...:...|  ::|.::|..:.:||||
Mouse   519 IHTGEKPYWC--SHCGKTFCSKSNLSKH 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 79/255 (31%)
C2H2 Zn finger 133..153 CDD:275368 5/19 (26%)
zf-H2C2_2 145..170 CDD:290200 6/24 (25%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 13/24 (54%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 7/21 (33%)
zf-H2C2_2 231..256 CDD:290200 8/24 (33%)
C2H2 Zn finger 247..267 CDD:275368 7/19 (37%)
C2H2 Zn finger 275..296 CDD:275368 2/20 (10%)
C2H2 Zn finger 304..324 CDD:275368 7/19 (37%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
C2H2 Zn finger 359..380 CDD:275368 7/19 (37%)
Zscan21NP_001038168.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..74
3 X 39 AA approximate tandem repeats 18..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 102..133
SCAN 118..230 CDD:128708 0/3 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..243 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..354 16/90 (18%)
COG5048 <339..535 CDD:227381 72/229 (31%)
C2H2 Zn finger 361..381 CDD:275368 8/19 (42%)
C2H2 Zn finger 389..409 CDD:275368 9/19 (47%)
C2H2 Zn finger 419..436 CDD:275368 6/16 (38%)
C2H2 Zn finger 444..464 CDD:275368 7/19 (37%)
C2H2 Zn finger 472..492 CDD:275368 7/19 (37%)
C2H2 Zn finger 500..520 CDD:275368 7/19 (37%)
C2H2 Zn finger 528..548 CDD:275368 7/19 (37%)
zf-C2H2 528..548 CDD:333835 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.