DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and M03D4.4

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001023313.1 Gene:M03D4.4 / 177375 WormBaseID:WBGene00019751 Length:505 Species:Caenorhabditis elegans


Alignment Length:521 Identity:122/521 - (23%)
Similarity:188/521 - (36%) Gaps:155/521 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENLQSQDDSEDVDLIFNEEGSCPLCNKT 139
            |.|.....:.|..::::|:..:|..|::.:|: ..|.|....:...||.|.:.:.:.|....|.|
 Worm    11 SGAFHSLDELQRHEREEHETVEQGDQEEDRME-DDSDELAMIKIKIEDSDFLSDTDSSQLSMNPT 74

  Fly   140 F-SRKSSLMTHIRNHSAER-KFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNL 202
            . |.|||        |.|: ::.|..||:.|.....|..|.|||:.::|:.|..|||.|.....|
 Worm    75 TPSEKSS--------SGEKGRYECEDCHEMFAVKRELATHMRIHSGEQPHSCTQCGKEFGTRQLL 131

  Fly   203 NNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNKKFTQVTSLNQHLQAH 267
            ..|...|||||..||  |.|.::|.|        |.|                    |.|||..|
 Worm   132 KKHWMWHTGERSHVC--PHCNKAFFQ--------KGH--------------------LTQHLMIH 166

  Fly   268 AGVTGYYCPRCPEKNFKLQSQLHTHMKTH---GLAFPYECDKCDEKFLQQAHLDQHLKMHDEFKF 329
            :|...:.||:| .|.|..:..|:.|||.|   |    :.|.:|...||:|..||:|       ..
 Worm   167 SGGRPHECPQC-HKTFIFKFDLNRHMKIHQERG----FSCQQCGRSFLKQVMLDEH-------HL 219

  Fly   330 KCDICPSS---------------------FNQESLL-----------KKHVQRHVEGRYLSCPVA 362
            ||...|||                     ..|||::           |..:|:....|       
 Worm   220 KCKGKPSSPIRSLLTPTMKAGLESAISIKPPQESMILSSETIAKMAQKLLIQQQENHR------- 277

  Fly   363 NCAESFAVRQHLSKHLLTNH----------------AHHELPPPK--------------RSKKAG 397
            |...:..|:||  :::|.|:                |..|:|.|.              .|:.:.
 Worm   278 NALNTLLVKQH--ENILNNNNNNESNILNGSVMHKDAGFEIPAPTIPLSLTCMICKSQFNSQPSF 340

  Fly   398 TLQ------TSQQPLAMIG--------QPLSLQHTTGQRGRPPKNKNK----ATTLAATAIKIEI 444
            ||.      .:|.|...|.        ||.::.|   |....|...:.    .|:.|::..|...
 Worm   341 TLHMYMHHIANQNPNLSIDSTHIHHTHQPTTISH---QNDPTPLGSDSDLATDTSCASSPQKTSP 402

  Fly   445 NESLHSQHI-------SNVSGLSIQQQINQHMQQQAAQQQAQQQAAQQQQQQAAQQQQQAAQQQQ 502
            .:.|.|..:       |:.||.|.|...::.............|.....:||..::.::....:|
 Worm   403 LQLLESSCLEQSSVSPSSSSGASPQPTASESSTSSCKDCTNSWQRVHDLEQQMVKKDEEFENYKQ 467

  Fly   503 L 503
            :
 Worm   468 M 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 80/290 (28%)
C2H2 Zn finger 133..153 CDD:275368 6/20 (30%)
zf-H2C2_2 145..170 CDD:290200 7/25 (28%)
C2H2 Zn finger 161..181 CDD:275368 7/19 (37%)
zf-H2C2_2 173..198 CDD:290200 11/24 (46%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..239 CDD:275368 6/21 (29%)
zf-H2C2_2 231..256 CDD:290200 2/24 (8%)
C2H2 Zn finger 247..267 CDD:275368 4/19 (21%)
C2H2 Zn finger 275..296 CDD:275368 9/20 (45%)
C2H2 Zn finger 304..324 CDD:275368 8/19 (42%)
C2H2 Zn finger 331..351 CDD:275368 9/51 (18%)
C2H2 Zn finger 359..380 CDD:275368 4/20 (20%)
M03D4.4NP_001023313.1 C2H2 Zn finger 90..110 CDD:275368 7/19 (37%)
zf-H2C2_2 102..127 CDD:290200 11/24 (46%)
C2H2 Zn finger 118..138 CDD:275368 7/19 (37%)
C2H2 Zn finger 146..166 CDD:275368 11/49 (22%)
zf-H2C2_2 158..181 CDD:290200 11/43 (26%)
zf-C2H2 172..194 CDD:278523 9/22 (41%)
C2H2 Zn finger 174..194 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.