Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848141.3 | Gene: | Zfp369 / 170936 | MGIID: | 2176229 | Length: | 845 | Species: | Mus musculus |
Alignment Length: | 316 | Identity: | 82/316 - (25%) |
---|---|---|---|
Similarity: | 133/316 - (42%) | Gaps: | 56/316 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 NNSN---------FHQSAAAAAAVAASASAAVAASAAAAATSSSTAS-SSDSDAIAQQQQHQ--- 85
Fly 86 -------NPQQQQHQNSQQQQQQQQQMQSSSSSEN-----------------------------L 114
Fly 115 QSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHER 179
Fly 180 IHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQ 244
Fly 245 YCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAF 300 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 63/177 (36%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 6/24 (25%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Zfp369 | NP_848141.3 | KRAB | 35..94 | CDD:214630 | |
KRAB | 35..74 | CDD:279668 | |||
SCAN | 179..266 | CDD:280241 | |||
KRAB | 300..>340 | CDD:214630 | |||
KRAB | 300..339 | CDD:279668 | |||
C2H2 Zn finger | 676..695 | CDD:275370 | 5/22 (23%) | ||
C2H2 Zn finger | 703..723 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 715..740 | CDD:290200 | 12/24 (50%) | ||
COG5048 | 727..>792 | CDD:227381 | 29/66 (44%) | ||
C2H2 Zn finger | 731..751 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 743..767 | CDD:290200 | 14/25 (56%) | ||
zf-C2H2 | 757..779 | CDD:278523 | 8/23 (35%) | ||
C2H2 Zn finger | 759..779 | CDD:275368 | 7/21 (33%) | ||
zf-C2H2 | 785..807 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 787..807 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 799..824 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 815..835 | CDD:275368 | 8/20 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |