Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081200.2 | Gene: | Ovol2 / 107586 | MGIID: | 1338039 | Length: | 274 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 52/202 - (25%) |
---|---|---|---|
Similarity: | 92/202 - (45%) | Gaps: | 29/202 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 ASASAAVAASAAAAATSSSTASSSDSDAIAQQQQHQNPQQQQHQNSQQQQQQQQQMQSSSSSENL 114
Fly 115 QSQDDSEDVDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHER 179
Fly 180 IHTNDRPYQCVDCGKTFTQITNLNNH-RRLH----------TGERPFVCNEPECGRSFAQVTNLN 233
Fly 234 NHMKSHH 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 41/128 (32%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 5/21 (24%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 4/10 (40%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | |||
C2H2 Zn finger | 275..296 | CDD:275368 | |||
C2H2 Zn finger | 304..324 | CDD:275368 | |||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
Ovol2 | NP_081200.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..88 | 7/46 (15%) | |
PHA00733 | <115..199 | CDD:177301 | 33/87 (38%) | ||
C2H2 Zn finger | 120..140 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 148..168 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 160..185 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 176..197 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 215..232 | CDD:275368 | 4/18 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |