DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zfp174

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006245901.1 Gene:Zfp174 / 102551846 RGDID:7498198 Length:406 Species:Rattus norvegicus


Alignment Length:148 Identity:53/148 - (35%)
Similarity:78/148 - (52%) Gaps:12/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 QQQMQSSSSSENL-QSQDDSEDVDLIFNEEGSCPLCNKTFSR-----KSSLMT---HIRNHSAER 157
            |.|::...|.:.| ..|....:::.|.|.....||.....||     .|||:.   |...||| :
  Rat   260 QWQVRPPQSPKPLPHYQRHCRELEYISNPLRGPPLRELKRSRGGRRSLSSLLQRLGHQAAHSA-K 323

  Fly   158 KFVCTYCHKGFTQAANLRNHERIHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPEC 222
            .:.|..|.|.||..:.|:.|.|:||.:|||.|.:||..|.:.:.|..|:|:||||:|:.|:  .|
  Rat   324 PYRCDDCGKSFTWNSELKRHTRVHTGERPYICGECGNCFGRQSTLKLHQRIHTGEKPYQCS--HC 386

  Fly   223 GRSFAQVTNLNNHMKSHH 240
            |:.|.|.:||:.|.:.||
  Rat   387 GKCFRQSSNLHQHHRLHH 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 48/125 (38%)
C2H2 Zn finger 133..153 CDD:275368 8/27 (30%)
zf-H2C2_2 145..170 CDD:290200 10/27 (37%)
C2H2 Zn finger 161..181 CDD:275368 8/19 (42%)
zf-H2C2_2 173..198 CDD:290200 12/24 (50%)
C2H2 Zn finger 189..209 CDD:275368 7/19 (37%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 5/10 (50%)
C2H2 Zn finger 247..267 CDD:275368
C2H2 Zn finger 275..296 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
Zfp174XP_006245901.1 SCAN 42..152 CDD:128708
SCAN 42..130 CDD:280241
zf-C2H2 325..347 CDD:278523 8/21 (38%)
C2H2 Zn finger 327..347 CDD:275368 8/19 (42%)
zf-H2C2_2 339..364 CDD:290200 12/24 (50%)
COG5048 351..>406 CDD:227381 25/56 (45%)
C2H2 Zn finger 355..375 CDD:275368 7/19 (37%)
zf-H2C2_2 368..392 CDD:290200 12/25 (48%)
C2H2 Zn finger 383..403 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.