DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and Zfp397

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001258404.1 Gene:Zfp397 / 100909408 RGDID:6504280 Length:527 Species:Rattus norvegicus


Alignment Length:394 Identity:104/394 - (26%)
Similarity:184/394 - (46%) Gaps:36/394 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FQVPGYSIPTCVRCSEQLTNNSNFHQSAAAAAAVAASASAAVAASAAAAATSSSTASSSDSDAIA 79
            |..||..:|...:.......:..:.:::..:.::..........|.....:|.:.:.::::.|..
  Rat   132 FDDPGQQVPDNPQGPSVSWKDLTYLRTSQDSTSIQVRPLKTQLKSWKPCLSSKNDSKNNETTAKE 196

  Fly    80 QQQQHQNPQ---------QQQHQNSQQQQQQQQQMQSSSSSE------NLQSQD--DSEDVDLIF 127
            ...:.:.|:         ..:|:::.:.||:...:...|.|:      :|..:|  |.....||.
  Rat   197 DISEEKAPEFSWDPSFRGVSEHKSNLEWQQRSSPLHRGSFSQVIFTHKSLAKRDHHDESQRCLIL 261

  Fly   128 NEEG-------------SCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHER 179
            :...             .|.:|..:|.:..||..|.|.|:.|:.:.|..|.|.|:..:.|..|::
  Rat   262 STNSVTCQKVSTDDRPYRCDVCGHSFKQHFSLTQHQRIHTGEKPYKCNQCGKAFSLRSYLIIHQK 326

  Fly   180 IHTNDRPYQCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQ 244
            ||:.::.|:|.:|||.|.|.:.|..||::||||:...||  |||::|:|.:.|..|.:.|...:.
  Rat   327 IHSGEKAYECNECGKAFNQSSALTRHRKIHTGEKACKCN--ECGKAFSQSSYLIIHQRIHTGEKP 389

  Fly   245 YCCNVCNKKFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDE 309
            |.||.|.|.|:|.:.|.:|.:.|.|...|.|..| .|.||..|:|.||.:.|....||||::|.:
  Rat   390 YRCNECGKTFSQSSKLIRHQRIHTGERPYECNEC-GKAFKQSSELITHQRIHSGEKPYECNECGK 453

  Fly   310 KFLQQAHLDQHLKMHD-EFKFKCDICPSSFNQESLLKKHVQRHVEGRYLSCPVANCAESFAVRQH 373
            .|...::|.:|.::|. |..::|:.|..:|.:.|.|.:|.:.|.......|  ..|.::|..|..
  Rat   454 AFSLNSNLIRHQRIHSGEEPYQCNDCGKTFKRSSALVQHQRIHSGDEAYIC--NECGKAFRHRSV 516

  Fly   374 LSKH 377
            |.:|
  Rat   517 LMRH 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 88/268 (33%)
C2H2 Zn finger 133..153 CDD:275368 7/19 (37%)
zf-H2C2_2 145..170 CDD:290200 10/24 (42%)
C2H2 Zn finger 161..181 CDD:275368 6/19 (32%)
zf-H2C2_2 173..198 CDD:290200 10/24 (42%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 9/21 (43%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 8/19 (42%)
C2H2 Zn finger 275..296 CDD:275368 9/20 (45%)
C2H2 Zn finger 304..324 CDD:275368 5/19 (26%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..380 CDD:275368 6/19 (32%)
Zfp397NP_001258404.1 SCAN 46..152 CDD:128708 4/19 (21%)
COG5048 <264..520 CDD:227381 85/260 (33%)
C2H2 Zn finger 280..300 CDD:275368 7/19 (37%)
C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
C2H2 Zn finger 336..356 CDD:275368 9/19 (47%)
C2H2 Zn finger 364..384 CDD:275368 9/21 (43%)
C2H2 Zn finger 392..412 CDD:275368 8/19 (42%)
C2H2 Zn finger 420..440 CDD:275368 9/20 (45%)
C2H2 Zn finger 448..468 CDD:275368 5/19 (26%)
C2H2 Zn finger 476..496 CDD:275368 6/19 (32%)
C2H2 Zn finger 504..524 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.