DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32772 and ZSCAN30

DIOPT Version :9

Sequence 1:NP_001284870.1 Gene:CG32772 / 31420 FlyBaseID:FBgn0052772 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001106205.1 Gene:ZSCAN30 / 100101467 HGNCID:33517 Length:494 Species:Homo sapiens


Alignment Length:332 Identity:94/332 - (28%)
Similarity:152/332 - (45%) Gaps:44/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RCSEQLTNNSNFHQ---SAAAAAAVAASASAAVAASAAAAATSSSTASSSDSDAIAQQ------- 81
            :|..:...:..|.:   ...|...:.|........::||..:.......:.|..||::       
Human   170 QCKTETQESQAFQERDGRMVAGKVLMAKQEIVECVASAAMISPGKLPGETHSQRIAEEALGGLDN 234

  Fly    82 --QQHQN---------PQQQQH------------QNSQQQQQQQQQMQSSSSSE-NLQSQDDSED 122
              :|..|         |.|.:|            ::|..:..:.:...|.:|:: ..||.|..|.
Human   235 SKKQKGNAAGNKISQLPSQDRHFSLATFNRRIPTEHSVLESHESEGSFSMNSNDITQQSVDTREK 299

  Fly   123 VDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPY 187
            :...|:       |.|.|.:.|.|:.|.|.|:.||.:.|..|.|.|:.:::|..|:|||:.::||
Human   300 LYECFD-------CGKAFCQSSKLIRHQRIHTGERPYACKECGKAFSLSSDLVRHQRIHSGEKPY 357

  Fly   188 QCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNK 252
            :|.:|||.|...:.|..|||:||||:|:.|.  |||::|::.:.|..|.|.|...:.|.|..|.|
Human   358 ECCECGKAFRGSSELIRHRRIHTGEKPYECG--ECGKAFSRSSALIQHKKIHTGDKSYECIACGK 420

  Fly   253 KFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHL 317
            .|.:.:.|.:|.:.|.|...|.|..| .|:|...|.|..|.:.|....||||.:|.:.|..::.|
Human   421 AFGRSSILIEHQRIHTGEKPYECNEC-GKSFNQSSALTQHQRIHTGEKPYECSECRKTFRHRSGL 484

  Fly   318 DQHLKMH 324
            .||.:.|
Human   485 MQHQRTH 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32772NP_001284870.1 COG5048 <124..378 CDD:227381 73/201 (36%)
C2H2 Zn finger 133..153 CDD:275368 7/19 (37%)
zf-H2C2_2 145..170 CDD:290200 10/24 (42%)
C2H2 Zn finger 161..181 CDD:275368 7/19 (37%)
zf-H2C2_2 173..198 CDD:290200 12/24 (50%)
C2H2 Zn finger 189..209 CDD:275368 9/19 (47%)
C2H2 Zn finger 217..239 CDD:275368 8/21 (38%)
zf-H2C2_2 231..256 CDD:290200 9/24 (38%)
C2H2 Zn finger 247..267 CDD:275368 6/19 (32%)
C2H2 Zn finger 275..296 CDD:275368 7/20 (35%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
C2H2 Zn finger 331..351 CDD:275368
C2H2 Zn finger 359..380 CDD:275368
ZSCAN30NP_001106205.1 SCAN 44..154 CDD:128708
SCAN 44..122 CDD:280241
COG5048 281..>360 CDD:227381 28/85 (33%)
zf-C2H2 301..323 CDD:278523 8/28 (29%)
C2H2 Zn finger 303..323 CDD:275368 8/26 (31%)
zf-H2C2_2 316..339 CDD:290200 9/22 (41%)
COG5048 <328..479 CDD:227381 57/153 (37%)
C2H2 Zn finger 331..351 CDD:275368 7/19 (37%)
zf-H2C2_2 343..366 CDD:290200 11/22 (50%)
C2H2 Zn finger 359..379 CDD:275368 9/19 (47%)
zf-H2C2_2 371..396 CDD:290200 14/26 (54%)
C2H2 Zn finger 387..407 CDD:275368 8/21 (38%)
zf-H2C2_2 399..424 CDD:290200 9/24 (38%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-H2C2_2 428..452 CDD:290200 9/24 (38%)
C2H2 Zn finger 443..463 CDD:275368 7/20 (35%)
zf-H2C2_2 455..480 CDD:290200 9/24 (38%)
C2H2 Zn finger 471..491 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23226
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.