Sequence 1: | NP_001284870.1 | Gene: | CG32772 / 31420 | FlyBaseID: | FBgn0052772 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106205.1 | Gene: | ZSCAN30 / 100101467 | HGNCID: | 33517 | Length: | 494 | Species: | Homo sapiens |
Alignment Length: | 332 | Identity: | 94/332 - (28%) |
---|---|---|---|
Similarity: | 152/332 - (45%) | Gaps: | 44/332 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 RCSEQLTNNSNFHQ---SAAAAAAVAASASAAVAASAAAAATSSSTASSSDSDAIAQQ------- 81
Fly 82 --QQHQN---------PQQQQH------------QNSQQQQQQQQQMQSSSSSE-NLQSQDDSED 122
Fly 123 VDLIFNEEGSCPLCNKTFSRKSSLMTHIRNHSAERKFVCTYCHKGFTQAANLRNHERIHTNDRPY 187
Fly 188 QCVDCGKTFTQITNLNNHRRLHTGERPFVCNEPECGRSFAQVTNLNNHMKSHHKVQQYCCNVCNK 252
Fly 253 KFTQVTSLNQHLQAHAGVTGYYCPRCPEKNFKLQSQLHTHMKTHGLAFPYECDKCDEKFLQQAHL 317
Fly 318 DQHLKMH 324 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32772 | NP_001284870.1 | COG5048 | <124..378 | CDD:227381 | 73/201 (36%) |
C2H2 Zn finger | 133..153 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 145..170 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 161..181 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 173..198 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 189..209 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 217..239 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 231..256 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 247..267 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 275..296 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 304..324 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 331..351 | CDD:275368 | |||
C2H2 Zn finger | 359..380 | CDD:275368 | |||
ZSCAN30 | NP_001106205.1 | SCAN | 44..154 | CDD:128708 | |
SCAN | 44..122 | CDD:280241 | |||
COG5048 | 281..>360 | CDD:227381 | 28/85 (33%) | ||
zf-C2H2 | 301..323 | CDD:278523 | 8/28 (29%) | ||
C2H2 Zn finger | 303..323 | CDD:275368 | 8/26 (31%) | ||
zf-H2C2_2 | 316..339 | CDD:290200 | 9/22 (41%) | ||
COG5048 | <328..479 | CDD:227381 | 57/153 (37%) | ||
C2H2 Zn finger | 331..351 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 343..366 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 359..379 | CDD:275368 | 9/19 (47%) | ||
zf-H2C2_2 | 371..396 | CDD:290200 | 14/26 (54%) | ||
C2H2 Zn finger | 387..407 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 399..424 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 415..435 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 428..452 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 443..463 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 455..480 | CDD:290200 | 9/24 (38%) | ||
C2H2 Zn finger | 471..491 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23226 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |