DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6927 and srsx-31

DIOPT Version :9

Sequence 1:NP_572194.1 Gene:CG6927 / 31419 FlyBaseID:FBgn0029733 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_001023767.1 Gene:srsx-31 / 3565162 WormBaseID:WBGene00008552 Length:308 Species:Caenorhabditis elegans


Alignment Length:194 Identity:36/194 - (18%)
Similarity:79/194 - (40%) Gaps:51/194 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 PITYDGALHL--TEFVLQRSWSNETVINADLSDLRHGAFAGNYSSLSFTVHLTRVVGFYLMDYFL 270
            |||:..||.:  .:|:   .::.:.:..|.|: |...||  .|.:.|..:...::|..|...||:
 Worm   132 PITFTSALMIYGYQFI---DYNTQIICMAPLA-LPRQAF--GYFTYSSNIINVKIVIVYAYTYFV 190

  Fly   271 --------------------PSMLIVAISWVSFWLQADQAPPRITLGTSTLLTFITLASAQGKTL 315
                                .::::|.|.|.:           :|:|.:     |.|...:.:..
 Worm   191 LRGYKERDANRMRYVFKSIALTVIVVLIGWTT-----------VTIGNT-----IALGVIEDRHT 239

  Fly   316 PKVSYIKVSEVWFLGCTIFIFGSMVEFAFVNTIWRRK-KSVPVKKLNSKHILKSTLSPNLLRRR 378
            .::..|.......:.|:|    :::.|..:|:.:|.. :.:...|::|..:.||  .|:::.:|
 Worm   240 SEIISIHAGFGVNISCSI----NVIVFYAINSEYRSAIRRLFGMKIHSSDVSKS--DPSVITKR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6927NP_572194.1 LIC 3..520 CDD:273305 36/194 (19%)
Neur_chan_LBD 36..259 CDD:280998 13/52 (25%)
Neur_chan_memb 270..518 CDD:280999 19/130 (15%)
srsx-31NP_001023767.1 TM helix 1 11..36 CDD:341315
7TM_GPCR_Srsx 19..277 CDD:255903 30/170 (18%)
TM helix 2 43..67 CDD:341315
TM helix 3 79..109 CDD:341315
TM helix 4 122..140 CDD:341315 4/7 (57%)
TM helix 5 165..190 CDD:341315 7/26 (27%)
TM helix 6 201..230 CDD:341315 5/44 (11%)
TM helix 7 241..266 CDD:341315 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3644
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.